Quick search:







Description Entry page for Effector - 'Tsk tyrosine kinase-Homo sapiens'
FamilyTyr protein kinases
Sub-FamilyTyr protein kinases
TypeTsk tyrosine kinase
Cross References:
References
UniProtQ08881 | B2R752 | Q32ML7
EMBLD13720 | L10717 | S65186 | AK312846 | CH471062 | BC109077 | BC109078
InterProIPR011993 | IPR001849 | IPR000719 | IPR017441 | IPR000980 | IPR001452 | IPR001245 | IPR008266 | IPR001562
PRODOMPD000001 | PD000093 | PD000066
GENEID3702
MIM186973
PRINTSPR00401 | PR00109
PFAMPF00779 | PF00169 | PF07714 | PF00017 | PF00018
Details:
Details
NameTsk tyrosine kinase-Homo sapiens
DescriptionRecName: Full=Tyrosine-protein kinase ITK/TSK; EC=2.7.10.2;AltName: Full=T-cell-specific kinase;AltName: Full=Tyrosine-protein kinase Lyk;AltName: Full=Kinase EMT
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneITK | EMT,LY
FunctionPlays a role in T-cell proliferation ands differentiation
Fragment0
Sequence
MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRI
KCVEIVKSDISIPCHYKYPFQVVHDNYLLYVFAPDRESRQRWVLALKEETRNNNSLVPKY
HPNFWMDGKWRCCSQLEKLATGCAQYDPTKNASKKPLPPTPEDNRRPLWEPEETVVIALY
DYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWY
NKSISRDKAEKLLLDTGKEGAFMVRDSRTAGTYTVSVFTKAVVSENNPCIKHYHIKETND
NPKRYYVAEKYVFDSIPLLINYHQHNGGGLVTRLRYPVCFGRQKAPVTAGLRYGKWVIDP
SELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHPKLVQ
LYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIH
RDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSD
VWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPE
DRPAFSRLLRQLAEIAESGL
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Ggamma-8_Homo sapiensStimulation15251227 | 14671004
2Gbeta-1_Homo sapiensStimulation15251227 | 14671004
3Ggamma-7_Homo sapiensStimulation15251227 | 14671004
4Ggamma-13_Homo sapiensStimulation15251227 | 14671004
5Gbeta-like_Homo sapiens_1Stimulation15251227 | 14671004
6Gbeta-4_Homo sapiensStimulation15251227 | 14671004
7Ggamma-t1_Homo sapiensStimulation15251227 | 14671004
8Gbeta-3_Homo sapiensStimulation15251227 | 14671004
9Ggamma-2_Homo sapiensStimulation15251227 | 14671004
10Ggamma-4_Homo sapiensStimulation15251227 | 14671004
11Ggamma-t2_Homo sapiensStimulation15251227 | 14671004
12Ggamma-10_Homo sapiensStimulation15251227 | 14671004
13Ggamma-3_Homo sapiensStimulation15251227 | 14671004
14Ggamma-12_Homo sapiensStimulation15251227 | 14671004
15Gbeta-5_Homo sapiensStimulation15251227 | 14671004
16Ggamma-5_Homo sapiensStimulation15251227 | 14671004
17Ggamma-11_Homo sapiensStimulation15251227 | 14671004
18Gbeta-2_Homo sapiensStimulation15251227 | 14671004
19Gbeta-like_Homo sapiens_2Stimulation15251227 | 14671004
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level