Quick search:







Description Entry page for Effector - 'Adenylate cyclase 7-Homo sapiens'
FamilyCyclases
Sub-FamilyAdenylate cyclases
TypeAdenylate cyclase 7
Cross References:
References
UniProtP51828 | A0AVA6
EMBLD25538 | BC126271
InterProIPR001054 | IPR018297 | IPR009398
PRODOM
GENEID113
MIM600385
PRINTS
PFAMPF06327 | PF00211
Details:
Details
NameAdenylate cyclase 7-Homo sapiens
DescriptionRecName: Full=Adenylate cyclase type 7; EC=4.6.1.1;AltName: Full=Adenylate cyclase type VII;AltName: Full=ATP pyrophosphate-lyase 7;AltName: Full=Adenylyl cyclase 7
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneADCY7 | KIAA003
FunctionThis is a membrane-bound, calcium-inhibitable adenylyls cyclase
Fragment0
Sequence
MPAKGRYFLNEGEEGPDQDALYEKYQLTSQHGPLLLTLLLVAATACVALIIIAFSQGDPS
RHQAILGMAFLVLAVFAALSVLMYVECLLRRWLRALALLTWACLVALGYVLVFDAWTKAA
CAWEQVPFFLFIVFVVYTLLPFSMRGAVAVGAVSTASHLLVLGSLMGGFTTPSVRVGLQL
LANAVIFLCGNLTGAFHKHQMQDASRDLFTYTVKCIQIRRKLRIEKRQQENLLLSVLPAH
ISMGMKLAIIERLKEHGDRRCMPDNNFHSLYVKRHQNVSILYADIVGFTQLASDCSPKEL
VVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDMCQAIKQ
VREATGVDINMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITEAT
LKHLDKAYEVEDGHGQQRDPYLKEMNIRTYLVIDPRSQQPPPPSQHLPRPKGDAALKMRA
SVRMTRYLESWGAARPFAHLNHRESVSSGETHVPNGRRPKSVPQRHRRTPDRSMSPKGRS
EDDSYDDEMLSAIEGLSSTRPCCSKSDDFYTFGSIFLEKGFEREYRLAPIPRARHDFACA
SLIFVCILLVHVLLMPRTAALGVSFGLVACVLGLVLGLCFATKFSRCCPARGTLCTISER
VETQPLLRLTLAVLTIGSLLTVAIINLPLMPFQVPELPVGNETGLLAASSKTRALCEPLP
YYTCSCVLGFIACSVFLRMSLEPKVVLLTVALVAYLVLFNLSPCWQWDCCGQGLGNLTKP
NGTTSGTPSCSWKDLKTMTNFYLVLFYITLLTLSRQIDYYCRLDCLWKKKFKKEHEEFET
MENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASVPDFKVFYTECDVNKE
GLECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAAGLSVASGHENQELERQHAH
IGVMVEFSIALMSKLDGINRHSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVAS
RMESTGELGKIQVTEETCTILQGLGYSCECRGLINVKGKGELRTYFVCTDTAKFQGLGLN
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Ggamma-13_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
2Ggamma-3_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
3Gbeta-4_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
4Ggamma-11_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
5Ggamma-8_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
6Ggamma-t1_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
7Gbeta-1_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
8Ggamma-2_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
9Ggamma-5_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
10Ggamma-10_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
11Galpha-s_Homo sapiens_2Stimulation15251227 | 15922020 | 14993377 | 11376933
12Ggamma-4_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
13Gbeta-like_Homo sapiens_1Stimulation15251227 | 15922020 | 14993377 | 11376933
14Gbeta-3_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
15Ggamma-12_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
16Gbeta-2_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
17Ggamma-7_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
18Ggamma-t2_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
19Galpha-s_Homo sapiens_1Stimulation15251227 | 15922020 | 14993377 | 11376933
20Gbeta-like_Homo sapiens_2Stimulation15251227 | 15922020 | 14993377 | 11376933
21Gbeta-5_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level