Quick search:







Description Entry page for Effector - 'Tubulin-Homo sapiens-1'
FamilyTubulins
Sub-FamilyTubulins
TypeTubulin
Cross References:
References
UniProtQ71U36 | P04687 | P05209
EMBLX01703 | AF141347 | BC006468 | BC050637 | K00557
InterProIPR002452 | IPR000217 | IPR018316 | IPR017975 | IPR003008
PRODOM
GENEID7846
MIM602529 | 611603
PRINTSPR01162 | PR01161
PFAMPF00091 | PF03953
Details:
Details
NameTubulin-Homo sapiens-1
DescriptionRecName: Full=Tubulin alpha-1A chain;AltName: Full=Tubulin B-alpha-1;AltName: Full=Tubulin alpha-3 chain;AltName: Full=Alpha-tubulin 3
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneTUBA1A | TUBA
FunctionTubulin is the major constituent of microtubules
Fragment0
Sequence
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD
RIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGVDSVEGEGEEEGEEY
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Gbeta-like_Homo sapiens_2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2Gbeta-3_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
3Galpha-s_Homo sapiens_1Stimulation of GTPase activity10224115 | 15251227 | 16380086
4Gbeta-1_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
5Ggamma-t1_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
6Galpha-i2_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
7Ggamma-10_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
8Ggamma-13_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
9Ggamma-t2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
10Gbeta-4_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
11Ggamma-7_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
12Ggamma-11_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
13Ggamma-12_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
14Gbeta-like_Homo sapiens_1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
15Ggamma-2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
16Galpha-q_Homo sapiensPotentiates receptor-induced PLC-beta activation16182515
17Gbeta-2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
18Galpha-i1_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
19Galpha-i3_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
20Gbeta-5_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
21Ggamma-4_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
22Ggamma-5_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
23Ggamma-8_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
24Galpha-o_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
25Galpha-s_Homo sapiens_2Stimulation of GTPase activity10224115 | 15251227 | 16380086
26Ggamma-3_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level