Quick search:







Description Entry page for Effector - 'Tubulin-Homo sapiens-10'
FamilyTubulins
Sub-FamilyTubulins
TypeTubulin
Cross References:
References
UniProtP07437 | P05218 | Q8WUC1 | Q9CY33
EMBLJ00314 | AF141349 | AF070561 | AF070593 | AF070600 | BA000025 | AB088100 | AB062393 | BC001938 | BC002347 | BC005838 | BC007605 | BC013374 | BC019924 | BC020946 | BC021909 | BC070326
InterProIPR013838 | IPR002453 | IPR000217 | IPR018316 | IPR017975 | IPR003008
PRODOM
GENEID203068
MIM191130
PRINTSPR01163 | PR01161
PFAMPF00091 | PF03953
Details:
Details
NameTubulin-Homo sapiens-10
DescriptionRecName: Full=Tubulin beta chain;AltName: Full=Tubulin beta-5 chain
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneTUBB | TUBB5 | OK/SW-cl.5
FunctionTubulin is the major constituent of microtubules
Fragment0
Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYV
PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEEDFGEEAEEEA
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Ggamma-13_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2Gbeta-5_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
3Galpha-s_Homo sapiens_2Stimulation of GTPase activity10224115 | 15251227 | 16380086
4Galpha-s_Homo sapiens_1Stimulation of GTPase activity10224115 | 15251227 | 16380086
5Galpha-i1_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
6Gbeta-2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
7Gbeta-3_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
8Galpha-i3_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
9Gbeta-like_Homo sapiens_1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
10Ggamma-t2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
11Galpha-q_Homo sapiensPotentiates receptor-induced PLC-beta activation16182515
12Gbeta-like_Homo sapiens_2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
13Galpha-i2_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
14Ggamma-7_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
15Gbeta-1_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
16Ggamma-4_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17Ggamma-11_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
18Ggamma-12_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
19Gbeta-4_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
20Ggamma-5_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
21Ggamma-2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
22Ggamma-10_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
23Ggamma-t1_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
24Galpha-o_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
25Ggamma-8_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
26Ggamma-3_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level