Quick search:







Description Entry page for Effector - 'Tubulin-Homo sapiens-14'
FamilyTubulins
Sub-FamilyTubulins
TypeTubulin
Cross References:
References
UniProtP68371 | A2BFA2 | P05217
EMBLX02344 | BX255925 | BC001911 | BC002783 | BC002885 | BC004188 | BC007889 | BC012835 | BC019359 | BC019829 | BC039175 | BC071889
InterProIPR013838 | IPR002453 | IPR000217 | IPR018316 | IPR017975 | IPR003008
PRODOM
GENEID10383
MIM602660
PRINTSPR01163 | PR01161
PFAMPF00091 | PF03953
Details:
Details
NameTubulin-Homo sapiens-14
DescriptionRecName: Full=Tubulin beta-2C chain;AltName: Full=Tubulin beta-2 chain
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneTUBB2
FunctionTubulin is the major constituent of microtubules
Fragment0
Sequence
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYV
PRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEGEFEEEAEEEVA
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Gbeta-4_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2Gbeta-1_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
3Ggamma-t1_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
4Galpha-q_Homo sapiensPotentiates receptor-induced PLC-beta activation16182515
5Galpha-s_Homo sapiens_2Stimulation of GTPase activity10224115 | 15251227 | 16380086
6Galpha-o_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
7Galpha-s_Homo sapiens_1Stimulation of GTPase activity10224115 | 15251227 | 16380086
8Gbeta-3_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
9Ggamma-11_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
10Ggamma-t2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
11Gbeta-2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
12Ggamma-13_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
13Ggamma-5_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
14Ggamma-4_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
15Gbeta-like_Homo sapiens_1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
16Ggamma-2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17Ggamma-3_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
18Ggamma-7_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
19Galpha-i1_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
20Ggamma-12_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
21Gbeta-5_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
22Galpha-i2_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
23Ggamma-8_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
24Ggamma-10_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
25Gbeta-like_Homo sapiens_2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
26Galpha-i3_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level