Quick search:







Description Entry page for Effector - 'Adenylate cyclase 8-Homo sapiens'
FamilyCyclases
Sub-FamilyAdenylate cyclases
TypeAdenylate cyclase 8
Cross References:
References
UniProtP40145
EMBLZ35309 | M83533
InterProIPR001054 | IPR018297 | IPR009398
PRODOM
GENEID114
MIM103070
PRINTS
PFAMPF06327 | PF00211
Details:
Details
NameAdenylate cyclase 8-Homo sapiens
DescriptionRecName: Full=Adenylate cyclase type 8; EC=4.6.1.1;AltName: Full=Adenylate cyclase type VIII;AltName: Full=ATP pyrophosphate-lyase 8;AltName: Full=Adenylyl cyclase 8;AltName: Full=Ca(2+)/calmodulin-activated adenylyl cyclase
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneADCY
FunctionThis is a membrane-bound, calcium-stimulable adenylyls cyclase
Fragment0
Sequence
MELSDVRCLTGSEELYTIHPTPPAGDGRSASRPQRLLWQTAVRHITEQRFIHGHRGGSGS
GSGGSGKASDPAGGGPNHHAPQLSGDSALPLYSLGPGERAHSTCGTKVFPERSGSGSASG
SGGGGDLGFLHLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRRK
SEVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDTTSHT
YLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLGTS
LLQVILQVVIPRLAVISINQVVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEAR
LRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADV
KGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAH
CCVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKL
ESGGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEDSLLSLPED
IVKESVSSSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHV
QSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVCAF
IVLLFITAIQSLLPSSRVMPMTIQFSILIMLHSALVLITTAEDYKCLPLILRKTCCWINE
TYLARNVIIFASILINFLGAILNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYFVFTG
VLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETVYAGLFLRYDNLNHSGEDFLGTKEV
SLLLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVA
RHFLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDE
LLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKH
SFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLIL
KDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLV
QSLNRQRQKQLLNENNNTGIIKGHYNRRTLLSPSGTEPGAQAEGTDKSDLP
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Galpha-s_Homo sapiens_1Stimulation15251227 | 15922020 | 14993377 | 11376933
2Galpha-s_Homo sapiens_2Stimulation15251227 | 15922020 | 14993377 | 11376933
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level