Quick search:







Description Entry page for Effector - 'Tubulin-Homo sapiens-19'
FamilyTubulins
Sub-FamilyTubulins
TypeTubulin
Cross References:
References
UniProtQ3ZCM7 | Q5SQX9 | Q8WZ78
EMBLAF355127 | CR590375 | AL713922 | CH471072 | BC101270 | BC101271
InterProIPR013838 | IPR002453 | IPR000217 | IPR018316 | IPR017975 | IPR003008
PRODOM
GENEID347688
MIM
PRINTSPR01163 | PR01161
PFAMPF00091 | PF03953
Details:
Details
NameTubulin-Homo sapiens-19
DescriptionRecName: Full=Tubulin beta-8 chain
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneTUBB
FunctionTubulin is the major constituent of microtubules
Fragment0
Sequence
MREIVLTQIGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHLQLERINVYYNEASGGRYV
PRAVLVDLEPGTMDSVRSGPFGQVFRPDNFIFGQCGAGNNWAKGHYTEGAELMESVMDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLLSKIREEYPDRIINTFSILPSPKVSDTVV
EPYNATLSVHQLIENADETFCIDNEALYDICSKTLKLPTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVAELTQQMFDAKNMM
AACDPRHGRYLTAAAIFRGRMPMREVDEQMFNIQDKNSSYFADWLPNNVKTAVCDIPPRG
LKMSATFIGNNTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEEDEEYAEEEVA
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Gbeta-5_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2Galpha-i1_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
3Gbeta-3_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
4Galpha-i3_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
5Ggamma-5_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
6Ggamma-8_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
7Gbeta-4_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
8Ggamma-3_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
9Galpha-q_Homo sapiensPotentiates receptor-induced PLC-beta activation16182515
10Ggamma-2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
11Gbeta-2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
12Ggamma-7_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
13Ggamma-10_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
14Gbeta-like_Homo sapiens_1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
15Ggamma-12_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
16Ggamma-13_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17Galpha-o_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
18Ggamma-t2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
19Galpha-s_Homo sapiens_2Stimulation of GTPase activity10224115 | 15251227 | 16380086
20Ggamma-4_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
21Gbeta-1_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
22Gbeta-like_Homo sapiens_2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
23Ggamma-11_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
24Ggamma-t1_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
25Galpha-i2_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
26Galpha-s_Homo sapiens_1Stimulation of GTPase activity10224115 | 15251227 | 16380086
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level