Quick search:







Description Entry page for Effector - 'Tubulin-Homo sapiens-21'
FamilyTubulins
Sub-FamilyTubulins
TypeTubulin
Cross References:
References
UniProtP23258 | Q53X79 | Q9BW59
EMBLM61764 | BT019931 | CR407642 | AK313339 | BC000619
InterProIPR002454 | IPR000217 | IPR018316 | IPR017975 | IPR003008
PRODOM
GENEID7283
MIM191135
PRINTSPR01164 | PR01161
PFAMPF00091 | PF03953
Details:
Details
NameTubulin-Homo sapiens-21
DescriptionRecName: Full=Tubulin gamma-1 chain;AltName: Full=Gamma-1-tubulin;AltName: Full=Gamma-tubulin complex component 1; Short=GCP-1
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneTUBG1 | TUB
FunctionTubulin is the major constituent of microtubules
Fragment0
Sequence
MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFATEGTDRKDVFFYQADDEHY
IPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFD
IIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSD
VVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSAST
TTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQP
KNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVAL
SRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDE
MDTSREIVQQLIDEYHAATRPDYISWGTQEQ
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Ggamma-13_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2Ggamma-5_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
3Ggamma-12_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
4Gbeta-4_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
5Ggamma-10_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
6Galpha-s_Homo sapiens_2Stimulation of GTPase activity10224115 | 15251227 | 16380086
7Gbeta-like_Homo sapiens_1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
8Galpha-o_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
9Ggamma-t2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
10Ggamma-t1_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
11Ggamma-8_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
12Gbeta-2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
13Gbeta-5_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
14Ggamma-4_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
15Galpha-s_Homo sapiens_1Stimulation of GTPase activity10224115 | 15251227 | 16380086
16Gbeta-like_Homo sapiens_2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17Ggamma-3_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
18Galpha-i3_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
19Gbeta-3_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
20Galpha-i2_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
21Ggamma-2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
22Gbeta-1_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
23Galpha-q_Homo sapiensPotentiates receptor-induced PLC-beta activation16182515
24Ggamma-7_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
25Ggamma-11_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
26Galpha-i1_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level