Quick search:







Description Entry page for Effector - 'Tubulin-Homo sapiens-24'
FamilyTubulins
Sub-FamilyTubulins
TypeTubulin
Cross References:
References
UniProtQ96CW5 | O43631 | O60852 | O60853 | Q7Z4K1 | Q96I79
EMBLAF042378 | AJ003061 | AJ003062 | BT009772 | AL139384 | AL160033 | AL160033 | AL139384 | BC007763 | BC013781 | BC046634
InterProIPR015697 | IPR007259
PRODOM
GENEID10426
MIM
PRINTS
PFAMPF04130
Details:
Details
NameTubulin-Homo sapiens-24
DescriptionRecName: Full=Gamma-tubulin complex component 3; Short=GCP-3; Short=hGCP3;AltName: Full=Spindle pole body protein Spc98 homolog; Short=hSpc98; Short=h104p
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneTUBGCP3 | GCP
FunctionGamma-tubulin complex is necessary for microtubules nucleation at the centrosome
Fragment0
Sequence
MATPDQKSPNVLLQNLCCRILGRSEADVAQQFQYAVRVIGSNFAPTVERDEFLVAEKIKK
ELIRQRREADAALFSELHRKLHSQGVLKNKWSILYLLLSLSEDPRRQPSKVSSYATLFAQ
ALPRDAHSTPYYYARPQTLPLSYQDRSAQSAQSSGSVGSSGISSIGLCALSGPAPAPQSL
LPGQSNQAPGVGDCLRQQLGSRLAWTLTANQPSSQATTSKGVPSAVSRNMTRSRREGDTG
GTMEITEAALVRDILYVFQGIDGKNIKMNNTENCYKVEGKANLSRSLRDTAVRLSELGWL
HNKIRRYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLEDDQGVNLGLES
SLTLRRLLVWTYDPKIRLKTLAALVDHCQGRKGGELASAVHAYTKTGDPYMRSLVQHILS
LVSHPVLSFLYRWIYDGELEDTYHEFFVASDPTVKTDRLWHDKYTLRKSMIPSFMTMDQS
RKVLLIGKSINFLHQVCHDQTPTTKMIAVTKSAESPQDAADLFTDLENAFQGKIDAAYFE
TSKYLLDVLNKKYSLLDHMQAMRRYLLLGQGDFIRHLMDLLKPELVRPATTLYQHNLTGI
LETAVRATNAQFDSPEILRRLDVRLLEVSPGDTGWDVFSLDYHVDGPIATVFTRECMSHY
LRVFNFLWRAKRMEYILTDIRKGHMCNAKLLRNMPEFSGVLHQCHILASEMVHFIHQMQY
YITFEVLECSWDELWNKVQQAQDLDHIIAAHEVFLDTIISRCLLDSDSRALLNQLRAVFD
QIIELQNAQDAIYRAALEELQRRLQFEEKKKQREIEGQWGVTAAEEEEENKRIGEFKESI
PKMCSQLRILTHFYQGIVQQFLVLLTTSSDESLRFLSFRLDFNEHYKAREPRLRVSLGTR
GRRSSHT
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Gbeta-1_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2Galpha-i1_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
3Galpha-s_Homo sapiens_2Stimulation of GTPase activity10224115 | 15251227 | 16380086
4Ggamma-8_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
5Ggamma-3_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
6Galpha-i3_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
7Ggamma-4_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
8Ggamma-2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
9Ggamma-10_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
10Ggamma-5_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
11Galpha-q_Homo sapiensPotentiates receptor-induced PLC-beta activation16182515
12Gbeta-3_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
13Gbeta-2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
14Ggamma-11_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
15Galpha-s_Homo sapiens_1Stimulation of GTPase activity10224115 | 15251227 | 16380086
16Ggamma-t2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17Galpha-o_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
18Gbeta-4_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
19Ggamma-13_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
20Gbeta-5_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
21Galpha-i2_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
22Ggamma-12_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
23Gbeta-like_Homo sapiens_2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
24Ggamma-t1_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
25Ggamma-7_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
26Gbeta-like_Homo sapiens_1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level