Quick search:







Description Entry page for Effector - 'Tubulin-Homo sapiens-25'
FamilyTubulins
Sub-FamilyTubulins
TypeTubulin
Cross References:
References
UniProtQ9UGJ1 | Q969X3 | Q9NVF0
EMBLAJ249677 | BC009870 | BC012801 | AK001639
InterProIPR007259
PRODOM
GENEID27229
MIM609610
PRINTS
PFAMPF04130
Details:
Details
NameTubulin-Homo sapiens-25
DescriptionRecName: Full=Gamma-tubulin complex component 4; Short=GCP-4; Short=hGCP4;AltName: Full=Hgrip76; Short=h76p
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneTUBGCP4 | 76P,GCP
FunctionGamma-tubulin complex is necessary for microtubules nucleation at the centrosome
Fragment0
Sequence
MIHELLLALSGYPGSIFTWNKRSGLQVSQDFPFLHPSETSVLNRLCRLGTDYIRFTEFIE
QYTGHVQQQDHHPSQQGQGGLHGIYLRAFCTGLDSVLQPYRQALLDLEQEFLGDPHLSIS
HVNYFLDQFQLLFPSVMVVVEQIKSQKIHGCQILETVYKHSCGGLPPVRSALEKILAVCH
GVMYKQLSAWMLHGLLLDQHEEFFIKQGPSSGNVSAQPEEDEEDLGIGGLTGKQLRELQD
LRLIEEENMLAPSLKQFSLRVEILPSYIPVRVAEKILFVGESVQMFENQNVNLTRKGSIL
KNQEDTFAAELHRLKQQPLFSLVDFEQVVDRIRSTVAEHLWKLMVEESDLLGQLKIIKDF
YLLGRGELFQAFIDTAQHMLKTPPTAVTEHDVNVAFQQSAHKVLLDDDNLLPLLHLTIEY
HGKEHKADATQAREGPSRETSPREAPASGWAALGLSYKVQWPLHILFTPAVLEKYNVVFK
YLLSVRRVQAELQHCWALQMQRKHLKSNQTDAIKWRLRNHMAFLVDNLQYYLQVDVLESQ
FSQLLHQINSTRDFESIRLAHDHFLSNLLAQSFILLKPVFHCLNEILDLCHSFCSLVSQN
LGPLDERGAAQLSILVKGFSRQSSLLFKILSSVRNHQINSDLAQLLLRLDYNKYYTQAGG
TLGSFGM
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Galpha-i2_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
2Galpha-q_Homo sapiensPotentiates receptor-induced PLC-beta activation16182515
3Galpha-i1_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
4Gbeta-2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
5Ggamma-11_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
6Ggamma-7_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
7Ggamma-5_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
8Gbeta-5_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
9Galpha-s_Homo sapiens_2Stimulation of GTPase activity10224115 | 15251227 | 16380086
10Gbeta-like_Homo sapiens_1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
11Gbeta-3_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
12Gbeta-4_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
13Ggamma-12_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
14Ggamma-8_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
15Gbeta-like_Homo sapiens_2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
16Ggamma-2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17Ggamma-10_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
18Ggamma-3_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
19Ggamma-13_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
20Gbeta-1_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
21Ggamma-t2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
22Ggamma-4_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
23Galpha-s_Homo sapiens_1Stimulation of GTPase activity10224115 | 15251227 | 16380086
24Galpha-i3_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
25Ggamma-t1_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
26Galpha-o_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level