Quick search:







Description Entry page for Effector - 'Adenylate cyclase 9-Homo sapiens'
FamilyCyclases
Sub-FamilyAdenylate cyclases
TypeAdenylate cyclase 9
Cross References:
References
UniProtO60503 | O60273 | Q4ZHT9 | Q4ZIR5 | Q9BWT4 | Q9UGP2
EMBLAF036927 | DQ008441 | DQ005545 | AJ133123 | AY028959 | AY028949 | AY028950 | AY028951 | AY028952 | AY028953 | AY028954 | AY028955 | AY028956 | AY028957 | AB011092
InterProIPR001054 | IPR018297
PRODOM
GENEID115
MIM603302
PRINTS
PFAMPF00211
Details:
Details
NameAdenylate cyclase 9-Homo sapiens
DescriptionRecName: Full=Adenylate cyclase type 9; EC=4.6.1.1;AltName: Full=Adenylate cyclase type IX;AltName: Full=ATP pyrophosphate-lyase 9;AltName: Full=Adenylyl cyclase 9
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneADCY9 | KIAA052
FunctionMay play a fundamental role in situations where fines interplay between intracellular calcium and cAMP determines thes cellular function
Fragment0
Sequence
MASPPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSSNSHPKHCKYSISSSCSSSGDS
GGVPRRVGGGGRLRRQKKLPQLFERASSRWWDPKFDSVNLEEACLERCFPQTQRRFRYAL
FYIGFACLLWSIYFAVHMRSRLIVMVAPALCFLLVCVGFFLFTFTKLYARHYAWTSLALT
LLVFALTLAAQFQVLTPVSGRGDSSNLTATARPTDTCLSQVGSFSMCIEVLFLLYTVMHL
PLYLSLCLGVAYSVLFETFGYHFRDEACFPSPGAGALHWELLSRGLLHGCIHAIGVHLFV
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGKVIERLGQSVVADQLKGLKTYLISGQRAKESRCSCAEALLSGFEVIDGSQVS
SGPRGQGTASSGNVSDLAQTVKTFDNLKTCPSCGITFAPKSEAGAEGGAPQNGCQDEHKN
STKASGGPNPKTQNGLLSPPQEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELERSYRTSYQEEVIKNSPVKTF
ASPTFSSLLDVFLSTTVFLTLSTTCFLKYEAATVPPPPAALAVFSAALLLEVLSLAVSIR
MVFFLEDVMACTKRLLEWIAGWLPRHCIGAILVSLPALAVYSHVTSEYETNIHFPVFTGS
AALIAVVHYCNFCQLSSWMRSSLATVVGAGPLLLLYVSLCPDSSVLTSPLDAVQNFSSER
NPCNSSVPRDLRRPASLIGQEVVLVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTK
IQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKE
CYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLNTAQAQDGSHPQEHLQILFE
FAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTT
GVECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYLYPKCTDHRVIPQHQLSISP
DIRVQVDGSIGRSPTDEIANLVPSVQYVDKTSLGSDSSTQAKDAHLSPKRPWKEPVKAEE
RGRFGKAIEKDDCDETGIEEANELTKLNVSKSV
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Galpha-s_Homo sapiens_1Stimulation15251227 | 15922020 | 14993377 | 11376933
2Galpha-s_Homo sapiens_2Stimulation15251227 | 15922020 | 14993377 | 11376933
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level