Quick search:







Description Entry page for Effector - 'Tubulin-Homo sapiens-4'
FamilyTubulins
Sub-FamilyTubulins
TypeTubulin
Cross References:
References
UniProtQ13748 | A6NJQ0 | Q5W099 | Q6PEY3 | Q96F18
EMBLAF005392 | AL139327 | CH471075 | BC011721 | BC057810 | L11645
InterProIPR002452 | IPR000217 | IPR018316 | IPR017975 | IPR003008
PRODOM
GENEID113457 | 7278
MIM602528
PRINTSPR01162 | PR01161
PFAMPF00091 | PF03953
Details:
Details
NameTubulin-Homo sapiens-4
DescriptionRecName: Full=Tubulin alpha-3C/D chain;AltName: Full=Alpha-tubulin 3C/D;AltName: Full=Tubulin alpha-2 chain;AltName: Full=Alpha-tubulin 2
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneTUBA3C | TUBA
FunctionTubulin is the major constituent of microtubules
Fragment0
Sequence
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLD
RIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGVDSVEAEAEEGEEY
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Ggamma-2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2Ggamma-12_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
3Ggamma-t2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
4Galpha-i3_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
5Gbeta-4_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
6Ggamma-3_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
7Galpha-i1_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
8Ggamma-5_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
9Ggamma-13_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
10Ggamma-10_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
11Gbeta-1_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
12Ggamma-4_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
13Gbeta-5_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
14Gbeta-like_Homo sapiens_2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
15Galpha-i2_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
16Ggamma-t1_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17Ggamma-7_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
18Gbeta-2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
19Galpha-o_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
20Ggamma-11_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
21Ggamma-8_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
22Gbeta-like_Homo sapiens_1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
23Galpha-s_Homo sapiens_1Stimulation of GTPase activity10224115 | 15251227 | 16380086
24Galpha-q_Homo sapiensPotentiates receptor-induced PLC-beta activation16182515
25Gbeta-3_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
26Galpha-s_Homo sapiens_2Stimulation of GTPase activity10224115 | 15251227 | 16380086
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level