Quick search:







Description Entry page for Effector - 'Tubulin-Homo sapiens-7'
FamilyTubulins
Sub-FamilyTubulins
TypeTubulin
Cross References:
References
UniProtQ9H853
EMBLAK024002 | AC068946
InterProIPR002452 | IPR000217 | IPR018316 | IPR003008
PRODOM
GENEID
MIM
PRINTSPR01162 | PR01161
PFAMPF00091 | PF03953
Details:
Details
NameTubulin-Homo sapiens-7
DescriptionRecName: Full=Putative tubulin-like protein alpha-4B;AltName: Full=Alpha-tubulin 4B
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneTUBA4B | TUBA
Function
Fragment0
Sequence
MRHQQTERQDPSQPLSRQHGTYRQIFHPEQLITGKEDAANNYAWGHYTIGKEFIDLLLDR
IRKLADQCTGLQGFLVFHSLGRGTGSDVTSFLMEWLSVNYGKKSKLGFSIYPAPQVSTAM
VQPYNSILTTHTTLEHSDCAFMVDNKAIYDICHCNLDIERPTYTNLNRLISQIVSSITAS
LRFDGALNVDLTEFQTNLVSYLTSTSPWPPMHQSSLQKRYTTSSCWWQRLPMPALSLPTR
W
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Ggamma-11_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2Ggamma-8_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
3Gbeta-3_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
4Ggamma-5_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
5Ggamma-13_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
6Gbeta-2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
7Gbeta-1_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
8Galpha-i3_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
9Galpha-s_Homo sapiens_2Stimulation of GTPase activity10224115 | 15251227 | 16380086
10Ggamma-t2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
11Galpha-s_Homo sapiens_1Stimulation of GTPase activity10224115 | 15251227 | 16380086
12Ggamma-2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
13Gbeta-like_Homo sapiens_2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
14Galpha-o_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
15Ggamma-4_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
16Ggamma-10_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17Gbeta-4_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
18Gbeta-5_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
19Gbeta-like_Homo sapiens_1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
20Galpha-i2_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
21Ggamma-t1_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
22Galpha-q_Homo sapiensPotentiates receptor-induced PLC-beta activation16182515
23Ggamma-7_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
24Galpha-i1_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
25Ggamma-3_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
26Ggamma-12_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level