Quick search:







Description Entry page for Effector - 'Tubulin-Homo sapiens-8'
FamilyTubulins
Sub-FamilyTubulins
TypeTubulin
Cross References:
References
UniProtQ9NY65 | B2RCX2 | Q2M3N4
EMBLAJ245922 | CR456600 | AK315316 | CH471193 | BC074827 | BC104845
InterProIPR002452 | IPR000217 | IPR018316 | IPR017975 | IPR003008
PRODOM
GENEID51807
MIM605742
PRINTSPR01162 | PR01161
PFAMPF00091 | PF03953
Details:
Details
NameTubulin-Homo sapiens-8
DescriptionRecName: Full=Tubulin alpha-8 chain;AltName: Full=Alpha-tubulin 8;AltName: Full=Tubulin alpha chain-like 2
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneTUBA8 | TUBAL
FunctionTubulin is the major constituent of microtubules
Fragment0
Sequence
MRECISVHVGQAGVQIGNACWELFCLEHGIQADGTFDAQASKINDDDSFTTFFSETGNGK
HVPRAVMIDLEPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGHYTVGKESIDLVLD
RIRKLTDACSGLQGFLIFHSFGGGTGSGFTSLLMERLSLDYGKKSKLEFAIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPIISAEKAYHEQLSVAEITSSCFEPNS
QMVKCDPRHGKYMACCMLYRGDVVPKDVNVAIAAIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGTDSFEEENEGEEF
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Ggamma-11_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2Ggamma-t2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
3Ggamma-2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
4Ggamma-t1_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
5Galpha-s_Homo sapiens_1Stimulation of GTPase activity10224115 | 15251227 | 16380086
6Gbeta-like_Homo sapiens_2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
7Gbeta-4_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
8Ggamma-12_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
9Ggamma-5_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
10Galpha-q_Homo sapiensPotentiates receptor-induced PLC-beta activation16182515
11Ggamma-10_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
12Ggamma-8_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
13Ggamma-3_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
14Galpha-i1_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
15Galpha-i2_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
16Ggamma-7_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17Ggamma-4_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
18Gbeta-5_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
19Gbeta-1_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
20Galpha-i3_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
21Gbeta-like_Homo sapiens_1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
22Ggamma-13_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
23Gbeta-3_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
24Galpha-o_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
25Galpha-s_Homo sapiens_2Stimulation of GTPase activity10224115 | 15251227 | 16380086
26Gbeta-2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level