Quick search:







Description Entry page for Effector - 'Tubulin-Homo sapiens-9'
FamilyTubulins
Sub-FamilyTubulins
TypeTubulin
Cross References:
References
UniProtA6NHL2 | B4DKL2 | Q4QQJ5 | Q9H6Z0
EMBLAK025318 | AK296616 | AL683826 | CH471072 | BC098247 | BC099716 | BC105634
InterProIPR002452 | IPR000217 | IPR018316 | IPR017975 | IPR003008
PRODOM
GENEID79861
MIM
PRINTSPR01162 | PR01161
PFAMPF00091 | PF03953
Details:
Details
NameTubulin-Homo sapiens-9
DescriptionRecName: Full=Tubulin alpha chain-like 3
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneTUBAL
FunctionTubulin is the major constituent of microtubules
Fragment0
Sequence
MRECLSIHIGQAGIQIGDACWELYCLEHGIQPNGVVLDTQQDQLENAKMEHTNASFDTFF
CETRAGKHVPRALFVDLEPTVIDGIRTGQHRSLFHPEQLLSGKEDAANNYARGRYSVGSE
VIDLVLERTRKLAEQCGGLQGFLIFRSFGGGTGSGFTSLLMERLTGEYSRKTKLEFSVYP
APRISTAVVEPYNSVLTTHSTTEHTDCTFMVDNEAVYDICHRKLGVECPSHASINRLVVQ
VVSSITASLRFEGPLNVDLIEFQTNLVPYPRIHFPMTAFAPIVSADKAYHEQFSVSDITT
ACFESSNQLVKCDPRLGKYMACCLLYRGDVVPKEVNAAIAATKSRHSVQFVDWCPTGFKV
GINNRPPTVMPGGDLAKVHRSICMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYLREGM
EEAEFLEAREDLAALERDYEEVAQSF
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Ggamma-12_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2Galpha-o_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
3Gbeta-4_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
4Gbeta-like_Homo sapiens_1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
5Ggamma-8_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
6Gbeta-2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
7Ggamma-11_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
8Ggamma-4_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
9Gbeta-3_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
10Ggamma-10_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
11Galpha-s_Homo sapiens_2Stimulation of GTPase activity10224115 | 15251227 | 16380086
12Galpha-i2_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
13Galpha-i3_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
14Ggamma-3_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
15Ggamma-t1_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
16Ggamma-5_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17Galpha-s_Homo sapiens_1Stimulation of GTPase activity10224115 | 15251227 | 16380086
18Gbeta-5_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
19Gbeta-like_Homo sapiens_2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
20Galpha-q_Homo sapiensPotentiates receptor-induced PLC-beta activation16182515
21Ggamma-7_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
22Ggamma-13_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
23Gbeta-1_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
24Galpha-i1_Homo sapiensStimulation of GTPase activity10224115 | 15251227 | 16380086
25Ggamma-t2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
26Ggamma-2_Homo sapiensIncreased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level