Quick search:







Description Entry page for Effector - 'Voltage dependent P/Q type calcium channel-Homo sapiens'
FamilyIon channels
Sub-FamilyVoltage dependent calcium channels
TypeVoltage dependent P/Q type calcium channel
Cross References:
References
UniProtO00555 | P78510 | P78511 | Q16290 | Q92690 | Q99790 | Q99791 | Q99792
EMBLAF004884 | AF004883 | X99897 | Z80114 | Z80115 | U79666 | U79663 | U79664 | U79665 | U79667 | U79668 | AC005305 | AC011446 | AC026805 | AC124224 | AC022436 | AC098781 | AC008540 | S76537 | U06702
InterProIPR005821 | IPR014873 | IPR005448 | IPR002077
PRODOM
GENEID773
MIM108500 | 141500 | 183086 | 601011
PRINTSPR00167 | PR01632
PFAMPF08763 | PF00520
Details:
Details
NameVoltage dependent P/Q type calcium channel-Homo sapiens
Description"RecName: Full=Voltage-dependent P/Q-type calcium channel subunit alpha-1A;AltName: Full=Voltage-gated calcium channel subunit alpha Cav2.1;AltName: Full=Calcium channel, L type, alpha-1 polypeptide isoform 4;AltName: Full=Brain calcium channel I; Short=BI;"
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCACNA1A | CACH4,CACN3,CACNL1A
FunctionVoltage-sensitive calcium channels (VSCC) mediate thes entry of calcium ions into excitable cells and are also involveds in a variety of calcium-dependent processes, including muscles contraction, hormone or neurotransmitter release, gene expression,s cell motility, cell division and cell death
Fragment0
Sequence
MARFGDEMPARYGGGGSGAAAGVVVGSGGGRGAGGSRQGGQPGAQRMYKQSMAQRARTMA
LYNPIPVRQNCLTVNRSLFLFSEDNVVRKYAKKITEWPPFEYMILATIIANCIVLALEQH
LPDDDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFAFHKGSYLRNGWNVMDFVVVLTG
ILATVGTEFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMIPLLQIGLLLFFAILIF
AIIGLEFYMGKFHTTCFEEGTDDIQGESPAPCGTEEPARTCPNGTKCQPYWEGPNNGITQ
FDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLS
GEFAKERERVENRRAFLKLRRQQQIERELNGYMEWISKAEEVILAEDETDGEQRHPFDGA
LRRTTIKKSKTDLLNPEEAEDQLADIASVGSPFARASIKSAKLENSTFFHKKERRMRFYI
RRMVKTQAFYWTVLSLVALNTLCVAIVHYNQPEWLSDFLYYAEFIFLGLFMSEMFIKMYG
LGTRPYFHSSFNCFDCGVIIGSIFEVIWAVIKPGTSFGISVLRALRLLRIFKVTKYWASL
RNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFDEGTPPTNFDTFPAAIMT
VFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVDNLANA
QELTKDEQEEEEAANQKLALQKAKEVAEVSPLSAANMSIAVKEQQKNQKPAKSVWEQRTS
EMRKQNLLASREALYNEMDPDERWKAAYTRHLRPDMKTHLDRPLVVDPQENRNNNTNKSR
AAEPTVDQRLGQQRAEDFLRKQARYHDRARDPSGSAGLDARRPWAGSQEAELSREGPYGR
ESDHHAREGSLEQPGFWEGEAERGKAGDPHRRHVHRQGGSRESRSGSPRTGADGEHRRHR
AHRRPGEEGPEDKAERRARHREGSRPARGGEGEGEGPDGGERRRRHRHGAPATYEGDARR
EDKERRHRRRKENQGSGVPVSGPNLSTTRPIQQDLGRQDPPLAEDIDNMKNNKLATAESA
APHGSLGHAGLPQSPAKMGNSTDPGPMLAIPAMATNPQNAASRRTPNNPGNPSNPGPPKT
PENSLIVTNPSGTQTNSAKTARKPDHTTVDIPPACPPPLNHTVVQVNKNANPDPLPKKEE
EKKEEEEDDRGEDGPKPMPPYSSMFILSTTNPLRRLCHYILNLRYFEMCILMVIAMSSIA
LAAEDPVQPNAPRNNVLRYFDYVFTGVFTFEMVIKMIDLGLVLHQGAYFRDLWNILDFIV
VSGALVAFAFTGNSKGKDINTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVFNI
LIVYMLFMFIFAVVAVQLFKGKFFHCTDESKEFEKDCRGKYLLYEKNEVKARDREWKKYE
FHYDNVLWALLTLFTVSTGEGWPQVLKHSVDATFENQGPSPGYRMEMSIFYVVYFVVFPF
FFVNIFVALIIITFQEQGDKMMEEYSLEKNERACIDFAISAKPLTRHMPQNKQSFQYRMW
QFVVSPPFEYTIMAMIALNTIVLMMKFYGASVAYENALRVFNIVFTSLFSLECVLKVMAF
GILNYFRDAWNIFDFVTVLGSITDILVTEFGNNFINLSFLRLFRAARLIKLLRQGYTIRI
LLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIGIDVEDEDSDEDEFQITEHNNFR
TFFQALMLLFRSATGEAWHNIMLSCLSGKPCDKNSGILTRECGNEFAYFYFVSFIFLCSF
LMLNLFVAVIMDNFEYLTRDSSILGPHHLDEYVRVWAEYDPAAWGRMPYLDMYQMLRHMS
PPLGLGKKCPARVAYKRLLRMDLPVADDNTVHFNSTLMALIRTALDIKIAKGGADKQQMD
AELRKEMMAIWPNLSQKTLDLLVTPHKSTDLTVGKIYAAMMIMEYYRQSKAKKLQAMREE
QDRTPLMFQRMEPPSPTQEGGPGQNALPSTQLDPGGALMAHESGLKESPSWVTQRAQEMF
QKTGTWSPEQGPPTDMPNSQPNSQSVEMREMGRDGYSDSEHYLPMEGQGRAASMPRLPAE
NQRRRGRPRGNNLSTISDTSPMKRSASVLGPKARRLDDYSLERVPPEENQRHHQRRRDRS
HRASERSLGRYTDVDTGLGTDLSMTTQSGDLPSKERDQERGRPKDRKHRQHHHHHHHHHH
PPPPDKDRYAQERPDHGRARARDQRWSRSPSEGREHMAHRQGSSSVSGSPAPSTSGTSTP
RRGRRQLPQTPSTPRPHVSYSPVIRKAGGSGPPQQQQQQQQQQQAVARPGRAATSGPRRY
PGPTAEPLAGDRPPTGGHSSGRSPRMERRVPGPARSESPRACRHGGARWPASGPHVSEGP
PGPRHHGYYRGSDYDEADGPGSGGGEEAMAGAYDAPPPVRHASSGATGRSPRTPRASGPA
CASPSRHGRRLPNGYYPAHGLARPRGPGSRKGLHEPYSESDDDWC
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Galpha-o_Homo sapiensInhibition15251227 | 11031246 | 11395521
2Ggamma-t1_Homo sapiensInhibition15251227 | 11031246
3Ggamma-11_Homo sapiensInhibition15251227 | 11031246
4Gbeta-5_Homo sapiensInhibition15251227 | 11031246
5Gbeta-like_Homo sapiens_2Inhibition15251227 | 11031246
6Ggamma-3_Homo sapiensInhibition15251227 | 11031246
7Ggamma-2_Homo sapiensInhibition15251227 | 11031246
8Gbeta-3_Homo sapiensInhibition15251227 | 11031246
9Gbeta-2_Homo sapiensInhibition15251227 | 11031246
10Ggamma-10_Homo sapiensInhibition15251227 | 11031246
11Ggamma-t2_Homo sapiensInhibition15251227 | 11031246
12Ggamma-8_Homo sapiensInhibition15251227 | 11031246
13Ggamma-12_Homo sapiensInhibition15251227 | 11031246
14Gbeta-1_Homo sapiensInhibition15251227 | 11031246
15Ggamma-13_Homo sapiensInhibition15251227 | 11031246
16Ggamma-5_Homo sapiensInhibition15251227 | 11031246
17Ggamma-7_Homo sapiensInhibition15251227 | 11031246
18Gbeta-4_Homo sapiensInhibition15251227 | 11031246
19Gbeta-like_Homo sapiens_1Inhibition15251227 | 11031246
20Ggamma-4_Homo sapiensInhibition15251227 | 11031246
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level