Quick search:







Description Entry page for Effector - 'Voltage dependent R type calcium channel-Homo sapiens'
FamilyIon channels
Sub-FamilyVoltage dependent calcium channels
TypeVoltage dependent R type calcium channel
Cross References:
References
UniProtQ15878 | B1AM14 | Q14580 | Q14581
EMBLL27745 | L29384 | L29385 | AL161734 | AL160059 | AL359270 | AL590998 | AL359270 | AL160059 | AL161734 | AL590998 | AL160059 | AL161734 | AL359270 | AL590998 | AL590998 | AL160059 | AL161734 | AL359270
InterProIPR018249 | IPR005821 | IPR014873 | IPR005449 | IPR002077
PRODOM
GENEID777
MIM601013
PRINTSPR00167 | PR01633
PFAMPF08763 | PF00520
Details:
Details
NameVoltage dependent R type calcium channel-Homo sapiens
Description"RecName: Full=Voltage-dependent R-type calcium channel subunit alpha-1E;AltName: Full=Voltage-gated calcium channel subunit alpha Cav2.3;AltName: Full=Calcium channel, L type, alpha-1 polypeptide, isoform 6;AltName: Full=Brain calcium channel II; Short=BII;"
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCACNA1E | CACH6,CACNL1A
FunctionVoltage-sensitive calcium channels (VSCC) mediate thes entry of calcium ions into excitable cells and are also involveds in a variety of calcium-dependent processes, including muscles contraction, hormone or neurotransmitter release, gene expression,s cell motility, cell division and cell death
Fragment0
Sequence
MARFGEAVVARPGSGDGDSDQSRNRQGTPVPASGQAAAYKQTKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECKDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSRT
EAMTRDSSDEHCVDISSVGTPLARASIKSAKVDGVSYFRHKERLLRISIRHMVKSQVFYW
IVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWN
EVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQ
RTSQLRKHMQMSSQEALNREEAPTMNPLNPLNPLSSLNPLNAHPSLYRRPRAIEGLALGL
ALEKFEEERISRGGSLKGDGGDRSSALDNQRTPLSLGQREPPWLARPCHGNCDPTQQEAG
GGEAVVTFEDRARHRQSQRRSRHRRVRTEGKESSSASRSRSASQERSLDEAMPTEGEKDH
ELRGNHGAKEPTIQEERAQDLRRTNSLMVSRGSGLAGGLDEADTPLVLPHPELEVGKHVV
LTEQEPEGSSEQALLGNVQLDMGRVISQSEPDLSCITANTDKATTESTSVTVAIPDVDPL
VDSTVVHISNKTDGEASPLKEAEIREDEEEVEKKKQKKEKRETGKAMVPHSSMFIFSTTN
PIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTFE
MVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLRVL
RVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTD
SSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQH
SVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLE
KNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYY
SAPCTYELALKYLNIAFTMVFSLECVLKVIAFGFLNYFRDTWNIFDFITVIGSITEIILT
DSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFI
YAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCEP
DTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHH
LDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAED
MTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPKA
SDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKALPY
LQQDPVSGLSGRSGYPSMSPLSPQDIFQLACMDPADDGQFQERQSLEPEVSELKSVQPSN
HGIYLPSDTQEHAGSGRASSMPRLTVDPQVVTDPSSMRRSFSTIRDKRSNSSWLEEFSME
RSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVSRC
NSEERGTQADWESPERRQSRSPSEGRSQTPNRQGTGSLSESSIPSVSDTSTPRRSRRQLP
PVPPKPRPLLSYSSLIRHAGSISPPADGSEEGSPLTSQALESNNACLTESSNSPHPQQSQ
HASPQRYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQMPN
GHYRRRRRGGPGPGMMCGAVNNLLSDTEEDDKC
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Galpha-o_Homo sapiensInhibition15251227 | 11031246
2Gbeta-2_Homo sapiensInhibition15251227 | 11031246
3Ggamma-10_Homo sapiensInhibition15251227 | 11031246
4Ggamma-5_Homo sapiensInhibition15251227 | 11031246
5Gbeta-5_Homo sapiensInhibition15251227 | 11031246
6Gbeta-like_Homo sapiens_2Inhibition15251227 | 11031246
7Ggamma-8_Homo sapiensInhibition15251227 | 11031246
8Ggamma-3_Homo sapiensInhibition15251227 | 11031246
9Ggamma-t2_Homo sapiensInhibition15251227 | 11031246
10Gbeta-1_Homo sapiensInhibition15251227 | 11031246
11Gbeta-3_Homo sapiensInhibition15251227 | 11031246
12Ggamma-7_Homo sapiensInhibition15251227 | 11031246
13Ggamma-13_Homo sapiensInhibition15251227 | 11031246
14Ggamma-12_Homo sapiensInhibition15251227 | 11031246
15Gbeta-like_Homo sapiens_1Inhibition15251227 | 11031246
16Ggamma-4_Homo sapiensInhibition15251227 | 11031246
17Ggamma-t1_Homo sapiensInhibition15251227 | 11031246
18Ggamma-11_Homo sapiensInhibition15251227 | 11031246
19Gbeta-4_Homo sapiensInhibition15251227 | 11031246
20Ggamma-2_Homo sapiensInhibition15251227 | 11031246
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level