Quick search:







Description Entry page for GPCR - 'BOMBESIN RECEPTORS_BB1_Homo sapiens_1'
ClassCLASS A
FamilyBOMBESIN RECEPTORS
Sub-FamilyBB1
Cross References:
References
UniProtP28336 | Q5VUK8
EMBLM73482 | AL589674 | CH471051
InterProIPR000276 | IPR001556 | IPR017452 | IPR001642
PRODOM
GENEID4829
MIM162341
PRINTSPR00358 | PR00237 | PR00639
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameBOMBESIN RECEPTORS_BB1_Homo sapiens_1
DescriptionRecName: Full=Neuromedin-B receptor; Short=NMB-R;AltName: Full=Neuromedin-B-preferring bombesin receptor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneNMB
FunctionReceptor for neuromedin-B
Fragment0
Sequence
MPSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYLLIITVGLLG
NIMLVKIFITNSAMRSVPNIFISNLAAGDLLLLLTCVPVDASRYFFDEWMFGKVGCKLIP
VIQLTSVGVSVFTLTALSADRYRAIVNPMDMQTSGALLRTCVKAMGIWVVSVLLAVPEAV
FSEVARISSLDNSSFTACIPYPQTDELHPKIHSVLIFLVYFLIPLAIISIYYYHIAKTLI
KSAHNLPGEYNEHTKKQMETRKRLAKIVLVFVGCFIFCWFPNHILYMYRSFNYNEIDPSL
GHMIVTLVARVLSFGNSCVNPFALYLLSESFRRHFNSQLCCGRKSYQERGTSYLLSSSAV
RMTSLKSNAKNMVTNSVLLNGHSMKQEMAL
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-15_Homo sapiensGq/118531502
2Galpha-14_Homo sapiensGq/118531502
3Galpha-11_Homo sapiensGq/118531502
4Galpha-q_Homo sapiensGq/118531502
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level