Quick search:







Description Entry page for GPCR - 'BOMBESIN RECEPTORS_BB3_Homo sapiens_2'
ClassCLASS A
FamilyBOMBESIN RECEPTORS
Sub-FamilyBB3
Cross References:
References
UniProtP32247
EMBLL08893 | X76498 | AY585193 | Z97632
InterProIPR000276 | IPR001560 | IPR001556 | IPR017452
PRODOM
GENEID680
MIM300107
PRINTSPR00637 | PR00358 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameBOMBESIN RECEPTORS_BB3_Homo sapiens_2
DescriptionRecName: Full=Bombesin receptor subtype-3; Short=BRS-3
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneBRS
FunctionRole in sperm cell division, maturation, or function
Fragment0
Sequence
MAQRQPHSPNQTLISITNDTESSSSVVSNDNTNKGWSGDNSPGIEALCAIYITYAVIISV
GILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGRIGC
KVLSFIRLTSVGVSVFTLTILSADRYKAVVKPLERQPSNAILKTCVKAGCVWIVSMIFAL
PEAIFSNVYTFRDPNKNMTFESCTSYPVSKKLLQEIHSLLCFLVFYIIPLSIISVYYSLI
ARTLYKSTLNIPTEEQSHARKQIESRKRIARTVLVLVALFALCWLPNHLLYLYHSFTSQT
YVDPSAMHFIFTIFSRVLAFSNSCVNPFALYWLSKSFQKHFKAQLFCCKAERPEPPVADT
SLTTLAVMGTVPGTGSIQMSEISVTSFTGCSVKQAEDRF
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-11_Homo sapiensGq/118383682
2Galpha-15_Homo sapiensGq/118383682
3Galpha-q_Homo sapiensGq/118383682
4Galpha-14_Homo sapiensGq/118383682
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level