Quick search:







Description Entry page for GPCR - 'BOMBESIN RECEPTORS_BB2_Homo sapiens_2'
ClassCLASS A
FamilyBOMBESIN RECEPTORS
Sub-FamilyBB2
Cross References:
References
UniProtP30550 | B2R910
EMBLM73481 | AF293323 | AF293321 | AF293322 | AK313588 | CH471074 | BC074733
InterProIPR000276 | IPR001556 | IPR001966 | IPR017452
PRODOM
GENEID2925
MIM305670
PRINTSPR00358 | PR00640 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameBOMBESIN RECEPTORS_BB2_Homo sapiens_2
DescriptionRecName: Full=Gastrin-releasing peptide receptor; Short=GRP-R;AltName: Full=GRP-preferring bombesin receptor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGRP
FunctionReceptor for gastrin releasing peptide (GRP)
Fragment0
Sequence
MALNDCFLLNLEVDHFMHCNISSHSADLPVNDDWSHPGILYVIPAVYGVIILIGLIGNIT
LIKIFCTVKSMRNVPNLFISSLALGDLLLLITCAPVDASRYLADRWLFGRIGCKLIPFIQ
LTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLKAAFIWIISMLLAIPEAVFSD
LHPFHEESTNQTFISCAPYPHSNELHPKIHSMASFLVFYVIPLSIISVYYYFIAKNLIQS
AYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSMLH
FVTSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPGLIIRSHSTGRSTTCMTS
LKSTNPSVATFSLINGNICHERYV
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-11_Homo sapiensGq/118531502
2Galpha-14_Homo sapiensGq/118531502
3Galpha-12_Homo sapiensG12/138531502
4Galpha-q_Homo sapiensGq/118531502
5Galpha-13_Homo sapiensG12/138531502
6Galpha-15_Homo sapiensGq/118531502
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level