Quick search:







Description Entry page for GPCR - 'BRADYKININ RECEPTORS_B1_Homo sapiens'
ClassCLASS A
FamilyBRADYKININ RECEPTORS
Sub-FamilyB1
Cross References:
References
UniProtP46663 | Q546S7 | Q8N0Y8
EMBLU12512 | U22346 | U48231 | AJ238044 | AB065896 | AY275464 | BC034705
InterProIPR000276 | IPR001186 | IPR000496 | IPR017452
PRODOM
GENEID623
MIM600337
PRINTSPR00425 | PR00993 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameBRADYKININ RECEPTORS_B1_Homo sapiens
DescriptionRecName: Full=B1 bradykinin receptor;AltName: Full=BK-1 receptor; Short=B1R
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneBDKRB1 | BRADYB
FunctionThis is a receptor for bradykinin
Fragment0
Sequence
MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-14_Homo sapiensGq/111657928
2Galpha-11_Homo sapiensGq/111657928
3Galpha-q_Homo sapiensGq/111657928
4Galpha-15_Homo sapiensGq/111657928
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level