Quick search:







Description Entry page for GPCR - 'BRADYKININ RECEPTORS_B2_Homo sapiens'
ClassCLASS A
FamilyBRADYKININ RECEPTORS
Sub-FamilyB2
Cross References:
References
UniProtP30411
EMBLM88714 | S56772 | X69680 | S45489 | L27594 | X86165 | X86164 | AY275465 | AF378542 | BC074894 | BC074895
InterProIPR000276 | IPR001504 | IPR000496 | IPR017452
PRODOM
GENEID624
MIM113503
PRINTSPR00425 | PR00994 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameBRADYKININ RECEPTORS_B2_Homo sapiens
DescriptionRecName: Full=B2 bradykinin receptor;AltName: Full=BK-2 receptor; Short=B2R
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneBDKRB2 | BKR
FunctionReceptor for bradykinin
Fragment0
Sequence
MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQ
PPFLWVLFVLATLENIFVLSVFCLHKSSCTVAEIYLGNLAAADLILACGLPFWAITISNN
FDWLFGETLCRVVNAIISMNLYSSICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSLV
IWGCTLLLSSPMLVFRTMKEYSDEGHNVTACVISYPSLIWEVFTNMLLNVVGFLLPLSVI
TFCTMQIMQVLRNNEMQKFKEIQTERRATVLVLVVLLLFIICWLPFQISTFLDTLHRLGI
LSSCQDERIIDVITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEVYQGVCQKGGCRSEP
IQMENSMGTLRTSISVERQIHKLQDWAGSRQ
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-15_Homo sapiensGq/111657928
2Galpha-11_Homo sapiensGq/111657928
3Galpha-13_Homo sapiensG12/131657928
4Galpha-14_Homo sapiensGq/111657928
5Galpha-q_Homo sapiensGq/111657928
6Galpha-12_Homo sapiensG12/131657928
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level