Quick search:







Description Entry page for GPCR - 'CANNABINOID RECEPTORS_CB1_Homo sapiens'
ClassCLASS A
FamilyCANNABINOID RECEPTORS
Sub-FamilyCB1
Cross References:
References
UniProtP21554 | B2R9T4 | Q13949 | Q495Z0 | Q4PLI4 | Q4VBM6 | Q5UB37 | Q9UNN0
EMBLX54937 | X81120 | X81121 | AY766182 | AF107262 | U73304 | DQ067455 | AY225225 | AL136096 | AK313908 | CH471051 | BC074811 | BC074812 | BC095513 | BC100968 | BC100969 | BC100970 | BC100971
InterProIPR000276 | IPR002230 | IPR000810 | IPR017452
PRODOM
GENEID1268
MIM114610
PRINTSPR00522 | PR00362 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameCANNABINOID RECEPTORS_CB1_Homo sapiens
DescriptionRecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R;AltName: Full=CANN6
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCNR1 | CN
FunctionInvolved in cannabinoid-induced CNS effects
Fragment0
Sequence
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIA
VLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVF
HRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLM
WTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWK
AHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLL
AIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQ
PLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i3_Homo sapiensGi/o2165569
2Galpha-i1_Homo sapiensGi/o2165569
3Galpha-o_Homo sapiensGi/o2165569
4Galpha-z_Homo sapiensGi/o2165569
5Galpha-i2_Homo sapiensGi/o2165569
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level