Quick search:







Description Entry page for GPCR - 'CANNABINOID RECEPTORS_CB2_Homo sapiens'
ClassCLASS A
FamilyCANNABINOID RECEPTORS
Sub-FamilyCB2
Cross References:
References
UniProtP34972 | Q4VBK8 | Q5JRH7 | Q6B0G7 | Q6NSY0
EMBLX74328 | AJ430063 | AJ430064 | AY242132 | AM156854 | AM156855 | AM156856 | AL590609 | CH471134 | BC069722 | BC074767 | BC095545
InterProIPR000276 | IPR001551 | IPR002230 | IPR017452
PRODOM
GENEID1269
MIM605051
PRINTSPR00523 | PR00362 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameCANNABINOID RECEPTORS_CB2_Homo sapiens
DescriptionRecName: Full=Cannabinoid receptor 2; Short=CB-2; Short=hCB2; Short=CB2;AltName: Full=CX5
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCNR
FunctionHeterotrimeric G protein-coupled receptor fors endocannabinoid 2-arachidonoylglycerol mediating inhibition ofs adenylate cyclase
Fragment0
Sequence
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i2_Homo sapiensGi/o7689702
2Galpha-i1_Homo sapiensGi/o7689702
3Galpha-z_Homo sapiensGi/o7689702
4Galpha-i3_Homo sapiensGi/o7689702
5Galpha-o_Homo sapiensGi/o7689702
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level