Quick search:







Description Entry page for GPCR - 'CHOLECYSTOKININ RECEPTORS_CCK1_Homo sapiens'
ClassCLASS A
FamilyCHOLECYSTOKININ RECEPTORS
Sub-FamilyCCK1
Cross References:
References
UniProtP32238 | B2R9Z5
EMBLL13605 | L19315 | U23430 | U23427 | U23428 | U23429 | D85606 | AY322549 | AK313978 | CH471069 | BC074987
InterProIPR000276 | IPR009126 | IPR000596 | IPR015276 | IPR017452
PRODOM
GENEID886
MIM118444
PRINTSPR01822 | PR00524 | PR00237
PFAMPF00001 | PF09193
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameCHOLECYSTOKININ RECEPTORS_CCK1_Homo sapiens
DescriptionRecName: Full=Cholecystokinin receptor type A;AltName: Full=CCK-A receptor; Short=CCK-AR;AltName: Full=Cholecystokinin-1 receptor; Short=CCK1-R
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCCKAR | CCKR
FunctionReceptor for cholecystokinin
Fragment0
Sequence
MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNT
LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYF
MGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS
NLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGI
KFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNS
SAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSY
TSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSH
MSASVPPQ
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-15_Homo sapiensGq/118503909
2Galpha-q_Homo sapiensGq/118503909
3Galpha-11_Homo sapiensGq/118503909
4Galpha-s_Homo sapiens_2Gs8503909
5Galpha-s_Homo sapiens_1Gs8503909
6Galpha-14_Homo sapiensGq/118503909
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level