Quick search:







Description Entry page for GPCR - 'CHOLECYSTOKININ RECEPTORS_CCK2_Homo sapiens'
ClassCLASS A
FamilyCHOLECYSTOKININ RECEPTORS
Sub-FamilyCCK2
Cross References:
References
UniProtP32239 | A8K7P9 | O75824 | Q16144 | Q92492 | Q96LC6 | Q9NYK7 | Q9UBV1
EMBLL04473 | L08112 | D13305 | L10822 | S70057 | D21219 | AF239668 | AY029770 | AF441129 | L07746 | AK292064 | AY322551 | BT006789 | BC000740 | AF074029 | AF074035
InterProIPR000276 | IPR009126 | IPR000314 | IPR017452
PRODOM
GENEID887
MIM118445
PRINTSPR01822 | PR00527 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameCHOLECYSTOKININ RECEPTORS_CCK2_Homo sapiens
DescriptionRecName: Full=Gastrin/cholecystokinin type B receptor; Short=CCK-B receptor; Short=CCK-BR;AltName: Full=Cholecystokinin-2 receptor; Short=CCK2-R
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCCKBR | CCKR
FunctionReceptor for gastrin and cholecystokinin
Fragment0
Sequence
MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITL
YAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF
IFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWL
LSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGL
ISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRS
RPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDG
PGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRAL
PDEDPPTPSIASLSRLSYTTISTLGPG
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-s_Homo sapiens_1Gs1280419
2Galpha-14_Homo sapiensGq/111280419
3Galpha-q_Homo sapiensGq/111280419
4Galpha-11_Homo sapiensGq/111280419
5Galpha-s_Homo sapiens_2Gs1280419
6Galpha-15_Homo sapiensGq/111280419
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level