Quick search:







Description Entry page for GPCR - 'DOPAMINE RECEPTORS_D1_Homo sapiens'
ClassCLASS A
FamilyDOPAMINE RECEPTORS
Sub-FamilyD1
Cross References:
References
UniProtP21728 | B2RA44 | Q4QRJ0
EMBLX55760 | X58987 | X55758 | S58541 | AB065677 | AF498961 | AK314031 | CH471062 | BC074978 | BC074979 | BC096837
InterProIPR000276 | IPR015694 | IPR001413 | IPR000929 | IPR017452
PRODOM
GENEID1812
MIM126449
PRINTSPR00565 | PR00242 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameDOPAMINE RECEPTORS_D1_Homo sapiens
DescriptionRecName: Full=D(1A) dopamine receptor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneDRD
FunctionThis is one of the five types (D1 to D5) of receptorss for dopamine
Fragment0
Sequence
MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA
ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN
CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS
GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET
VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL
SVILDYDTDVSLEKIQPITQNGQHPT
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-s_Homo sapiens_1Gs2144334
2Galpha-s_Homo sapiens_2Gs2144334
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level