Quick search:







Description Entry page for GPCR - 'DOPAMINE RECEPTORS_D2_Homo sapiens'
ClassCLASS A
FamilyDOPAMINE RECEPTORS
Sub-FamilyD2
Cross References:
References
UniProtP14416 | Q9NZR3 | Q9UPA9
EMBLM30625 | X51645 | X51646 | X51362 | M29066 | S62137 | S69899 | S58589 | S58577 | S58584 | S58586 | S58588 | AF176812 | AB065860 | AF050737 | BC021195
InterProIPR000276 | IPR001922 | IPR000929 | IPR017452
PRODOM
GENEID1813
MIM103780 | 126450 | 159900 | 608516
PRINTSPR00567 | PR00242 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameDOPAMINE RECEPTORS_D2_Homo sapiens
DescriptionRecName: Full=D(2) dopamine receptor;AltName: Full=Dopamine D2 receptor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneDRD
FunctionThis is one of the five types (D1 to D5) of receptorss for dopamine
Fragment0
Sequence
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
VNPIIYTTFNIEFRKAFLKILHC
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-o_Homo sapiensGi/o2974511
2Galpha-z_Homo sapiensGi/o2974511
3Galpha-i1_Homo sapiensGi/o2974511
4Galpha-i3_Homo sapiensGi/o2974511
5Galpha-i2_Homo sapiensGi/o2974511
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level