Quick search:







Description Entry page for GPCR - 'DOPAMINE RECEPTORS_D3_Homo sapiens'
ClassCLASS A
FamilyDOPAMINE RECEPTORS
Sub-FamilyD3
Cross References:
References
UniProtP35462 | Q4VBM8
EMBLU32499 | L20469 | L35903 | L35902 | BC095510
InterProIPR000276 | IPR001620 | IPR000929 | IPR017452
PRODOM
GENEID1814
MIM126451 | 190300
PRINTSPR00568 | PR00242 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameDOPAMINE RECEPTORS_D3_Homo sapiens
DescriptionRecName: Full=D(3) dopamine receptor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneDRD
FunctionThis is one of the five types (D1 to D5) of receptorss for dopamine
Fragment0
Sequence
MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i3_Homo sapiensGi/o1975644
2Galpha-z_Homo sapiensGi/o1975644
3Galpha-i1_Homo sapiensGi/o1975644
4Galpha-o_Homo sapiensGi/o1975644
5Galpha-i2_Homo sapiensGi/o1975644
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level