Quick search:







Description Entry page for GPCR - 'DOPAMINE RECEPTORS_D4_Homo sapiens'
ClassCLASS A
FamilyDOPAMINE RECEPTORS
Sub-FamilyD4
Cross References:
References
UniProtP21917 | Q7Z7Q5
EMBLL12398 | L12397 | AP006284
InterProIPR000276 | IPR002185 | IPR000929 | IPR017452
PRODOM
GENEID1815
MIM126452
PRINTSPR00569 | PR00242 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameDOPAMINE RECEPTORS_D4_Homo sapiens
DescriptionRecName: Full=D(4) dopamine receptor;AltName: Full=Dopamine D4 receptor;AltName: Full=D(2C) dopamine receptor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneDRD
FunctionThis is one of the five types (D1 to D5) of receptorss for dopamine
Fragment0
Sequence
MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVA
TERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCT
ASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGR
DPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRAKLHGRAPRRPSG
PGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPGLPPDPCGPDCAPPAPG
LPQDPCGPDCAPPAPGLPRGPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPPDPCGSNCAP
PDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWTPFFVVHITQALC
PACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-o_Homo sapiensGi/o1840645
2Galpha-z_Homo sapiensGi/o1840645
3Galpha-i3_Homo sapiensGi/o1840645
4Galpha-i2_Homo sapiensGi/o1840645
5Galpha-i1_Homo sapiensGi/o1840645
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level