Quick search:







Description Entry page for GPCR - 'DOPAMINE RECEPTORS_D5_Homo sapiens'
ClassCLASS A
FamilyDOPAMINE RECEPTORS
Sub-FamilyD5
Cross References:
References
UniProtP21918 | B2R9S3 | Q8NEQ8
EMBLX58454 | M67439 | AY136750 | AK313897 | CH471069 | BC009748
InterProIPR000276 | IPR015694 | IPR000497 | IPR000929 | IPR017452
PRODOM
GENEID1816
MIM126453 | 606798
PRINTSPR00566 | PR00242 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameDOPAMINE RECEPTORS_D5_Homo sapiens
DescriptionRecName: Full=D(1B) dopamine receptor;AltName: Full=D1beta dopamine receptor;AltName: Full=D(5) dopamine receptor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneDRD5 | DRD1B,DRD1L
FunctionThis is one of the five types (D1 to D5) of receptorss for dopamine
Fragment0
Sequence
MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVL
VCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFD
IMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNW
HRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAI
MIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSV
IMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYA
FNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTP
GNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-s_Homo sapiens_1Gs1831904
2Galpha-s_Homo sapiens_2Gs1831904
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level