Quick search:







Description Entry page for GPCR - 'ENDOTHELIN RECEPTORS_ETA_Homo sapiens'
ClassCLASS A
FamilyENDOTHELIN RECEPTORS
Sub-FamilyETA
Cross References:
References
UniProtP25101 | B2R723 | O43441 | Q16432 | Q16433 | Q8TBH2
EMBLS63938 | S67127 | X61950 | D90348 | S57498 | L06622 | D11151 | S45956 | S81539 | S81542 | S81545 | AY275462 | AY422989 | AK312812 | CH471056 | BC022511 | S55772 | AF014826
InterProIPR000276 | IPR000499 | IPR002175 | IPR017452
PRODOM
GENEID1909
MIM131243
PRINTSPR00570 | PR00366 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameENDOTHELIN RECEPTORS_ETA_Homo sapiens
DescriptionRecName: Full=Endothelin-1 receptor;AltName: Full=Endothelin A receptor; Short=hET-AR; Short=ETA-R; Short=ET-A;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneEDNRA | ETA,ETR
FunctionReceptor for endothelin-1
Fragment0
Sequence
METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLP
SNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALS
VDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCM
LNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ
RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATM
NSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRS
SHKDSMN
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i2_Homo sapiensGi/o1849646
2Galpha-s_Homo sapiens_2Gs1849646
3Galpha-i1_Homo sapiensGi/o1849646
4Galpha-o_Homo sapiensGi/o1849646
5Galpha-s_Homo sapiens_1Gs1849646
6Galpha-i3_Homo sapiensGi/o1849646
7Galpha-z_Homo sapiensGi/o1849646
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level