Quick search:







Description Entry page for GPCR - 'ENDOTHELIN RECEPTORS_ETB_Homo sapiens'
ClassCLASS A
FamilyENDOTHELIN RECEPTORS
Sub-FamilyETB
Cross References:
References
UniProtP24530 | A2A2Z8 | A8K3T4 | O15343 | Q59GB1 | Q5W0G9 | Q8NHM6 | Q8NHM7
EMBLM74921 | D90402 | S44866 | S57283 | D13168 | L06623 | X99250 | AF114165 | AY275463 | AB209198 | AK290699 | AY547312 | AL139002 | AL139002 | CH471093 | CH471093 | BC014472 | AJ458188 | AJ458189 | AJ458190 | AJ458191
InterProIPR000276 | IPR000499 | IPR001112 | IPR017452
PRODOM
GENEID1910
MIM131244 | 142623 | 277580 | 600155 | 600501
PRINTSPR00571 | PR00366 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameENDOTHELIN RECEPTORS_ETB_Homo sapiens
DescriptionRecName: Full=Endothelin B receptor; Short=ET-B;AltName: Full=Endothelin receptor non-selective type;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneEDNRB | ETR
FunctionNon-specific receptor for endothelin 1, 2, and 3
Fragment0
Sequence
MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNA
SLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNS
TLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFI
QKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGF
DIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEM
LRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCEL
LSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSC
LKFKANDHGYDNFRSSNKYSSS
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i1_Homo sapiensGi/o1848367
2Galpha-i3_Homo sapiensGi/o1848367
3Galpha-14_Homo sapiensGq/111848367
4Galpha-z_Homo sapiensGi/o1848367
5Galpha-11_Homo sapiensGq/111848367
6Galpha-15_Homo sapiensGq/111848367
7Galpha-q_Homo sapiensGq/111848367
8Galpha-i2_Homo sapiensGi/o1848367
9Galpha-o_Homo sapiensGi/o1848367
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level