Quick search:







Description Entry page for GPCR - 'ENDOTHELIN RECEPTORS_ETBL_Homo sapiens_1'
ClassCLASS A
FamilyENDOTHELIN RECEPTORS
Sub-FamilyETBL
Cross References:
References
UniProtO60883 | Q5SXP7 | Q86VP7
EMBLY16280 | AK222639 | AL592300 | BC050334
InterProIPR000276 | IPR017452 | IPR003909
PRODOM
GENEID9283
MIM
PRINTSPR00237 | PR01421
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameENDOTHELIN RECEPTORS_ETBL_Homo sapiens_1
DescriptionRecName: Full=Endothelin B receptor-like protein 2; Short=ETBR-LP-2;AltName: Full=G-protein coupled receptor 37-like 1;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGPR37L1 | ETBRLP
FunctionOrphan receptor
Fragment0
Sequence
MRWLWPLAVSLAVILAVGLSRVSGGAPLHLGRHRAETQEQQSRSKRGTEDEEAKGVQQYV
PEEWAEYPRPIHPAGLQPTKPLVATSPNPDKDGGTPDSGQELRGNLTGAPGQRLQIQNPL
YPVTESSYSAYAIMLLALVVFAVGIVGNLSVMCIVWHSYYLKSAWNSILASLALWDFLVL
FFCLPIVIFNEITKQRLLGDVSCRAVPFMEVSSLGVTTFSLCALGIDRFHVATSTLPKVR
PIERCQSILAKLAVIWVGSMTLAVPELLLWQLAQEPAPTMGTLDSCIMKPSASLPESLYS
LVMTYQNARMWWYFGCYFCLPILFTVTCQLVTWRVRGPPGRKSECRASKHEQCESQLNST
VVGLTVVYAFCTLPENVCNIVVAYLSTELTRQTLDLLGLINQFSTFFKGAITPVLLLCIC
RPLGQAFLDCCCCCCCEECGGASEASAANGSDNKLKTEVSSSIYFHKPRESPPLLPLGTP
C
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-14_Homo sapiensGq/111848367
2Galpha-i3_Homo sapiensGi/o1848367
3Galpha-i2_Homo sapiensGi/o1848367
4Galpha-o_Homo sapiensGi/o1848367
5Galpha-11_Homo sapiensGq/111848367
6Galpha-q_Homo sapiensGq/111848367
7Galpha-z_Homo sapiensGi/o1848367
8Galpha-i1_Homo sapiensGi/o1848367
9Galpha-15_Homo sapiensGq/111848367
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level