Quick search:







Description Entry page for GPCR - 'ENDOTHELIN RECEPTORS_ETBL_Homo sapiens_2'
ClassCLASS A
FamilyENDOTHELIN RECEPTORS
Sub-FamilyETBL
Cross References:
References
UniProtO15354 | O00348 | O14768 | Q8TD39
EMBLY12476 | Y12477 | AF017262 | U87460 | AF502281 | AC004925 | BC040007
InterProIPR000276 | IPR017452 | IPR003909
PRODOM
GENEID2861
MIM602583
PRINTSPR00237 | PR01421
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameENDOTHELIN RECEPTORS_ETBL_Homo sapiens_2
DescriptionRecName: Full=Probable G-protein coupled receptor 37;AltName: Full=Endothelin B receptor-like protein 1; Short=ETBR-LP-1;AltName: Full=Parkin-associated endothelin receptor-like receptor; Short=PAELR;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGPR3
FunctionOrphan receptor
Fragment0
Sequence
MRAPGALLARMSRLLLLLLLKVSASSALGVAPASRNETCLGESCAPTVIQRRGRDAWGPG
NSARDVLRARAPREEQGAAFLAGPSWDLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPW
RWKGARGQEPSETLGRGNPTALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLF
YWPRRAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNS
TNRRVRLKNPFYPLTQESYGAYAVMCLSVVIFGTGIIGNLAVMCIVCHNYYMRSISNSLL
ANLAFWDFLIIFFCLPLVIFHELTKKWLLEDFSCKIVPYIEVASLGVTTFTLCALCIDRF
RAATNVQMYYEMIENCSSTTAKLAVIWVGALLLALPEVVLRQLSKEDLGFSGRAPAERCI
IKISPDLPDTIYVLALTYDSARLWWYFGCYFCLPTLFTITCSLVTARKIRKAEKACTRGN
KRQIQLESQMNCTVVALTILYGFCIIPENICNIVTAYMATGVSQQTMDLLNIISQFLLFF
KSCVTPVLLFCLCKPFSRAFMECCCCCCEECIQKSSTVTSDDNDNEYTTELELSPFSTIR
REMSTFASVGTHC
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-14_Homo sapiensGq/111848367
2Galpha-i2_Homo sapiensGi/o1848367
3Galpha-z_Homo sapiensGi/o1848367
4Galpha-q_Homo sapiensGq/111848367
5Galpha-i1_Homo sapiensGi/o1848367
6Galpha-15_Homo sapiensGq/111848367
7Galpha-o_Homo sapiensGi/o1848367
8Galpha-11_Homo sapiensGq/111848367
9Galpha-i3_Homo sapiensGi/o1848367
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level