Quick search:







Description Entry page for GPCR - 'ESTROGEN RECEPTORS_GPER_Homo sapiens'
ClassCLASS A
FamilyESTROGEN RECEPTORS
Sub-FamilyGPER
Cross References:
References
UniProtQ99527 | A8K6C5 | B5BUJ1 | O00143 | O43494 | Q13631 | Q6FHL1 | Q96F42
EMBLY08162 | U77827 | AF015257 | X98510 | U63917 | AF027956 | U58828 | CR541741 | AK291590 | AB451427 | CH236953 | CH471144 | BC011634
InterProIPR000276 | IPR017452 | IPR015692
PRODOM
GENEID2852
MIM601805
PRINTSPR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameESTROGEN RECEPTORS_GPER_Homo sapiens
DescriptionRecName: Full=G-protein coupled estrogen receptor 1;AltName: Full=Membrane estrogen receptor; Short=mER;AltName: Full=G-protein coupled receptor 30;AltName: Full=Chemokine receptor-like 2;AltName: Full=IL8-related receptor DRY12;AltName: Full=Flow-induced endothelial G-protein coupled receptor 1; Short=FEG-1;AltName: Full=Lymphocyte-derived G-protein coupled receptor; Short=LYGPR;AltName: Full=GPCR-BR
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGPER | CEPR,CMKRL2,DRY12,GPR3
FunctionReceptor for estrogen
Fragment0
Sequence
MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLF
LSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLH
ERYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHARLSCGL
IWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRV
LVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRH
AHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVI
PDSTEQSDVRFSSAV
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i2_Homo sapiensGi/o18406603
2Galpha-i1_Homo sapiensGi/o18406603
3Galpha-i3_Homo sapiensGi/o18406603
4Galpha-o_Homo sapiensGi/o18406603
5Galpha-z_Homo sapiensGi/o18406603
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level