Quick search:







Description Entry page for GPCR - 'FORMYL-PEPTIDE RECEPTORS_FPR2_Homo sapiens'
ClassCLASS A
FamilyFORMYL-PEPTIDE RECEPTORS
Sub-FamilyFPR2
Cross References:
References
UniProtP25090 | A8K3E2
EMBLM76672 | X63819 | M88107 | M84562 | D10922 | U81501 | AF054013 | AY225226 | AK290557 | AC018755 | CH471135 | BC029125 | BC071722
InterProIPR000276 | IPR015691 | IPR000826 | IPR017452
PRODOM
GENEID2358
MIM136538
PRINTSPR00526 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameFORMYL-PEPTIDE RECEPTORS_FPR2_Homo sapiens
DescriptionRecName: Full=N-formyl peptide receptor 2;AltName: Full=FMLP-related receptor I; Short=FMLP-R-I;AltName: Full=Formyl peptide receptor-like 1;AltName: Full=Lipoxin A4 receptor; Short=LXA4 receptor;AltName: Full=RFP;AltName: Full=HM63
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneFPR2 | FPRH1,FPRL1,LXA4
FunctionLow affinity receptor for N-formyl-methionyl peptides,s which are powerful neutrophils chemotactic factors
Fragment0
Sequence
METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVT
TICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIA
LDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNF
ASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPL
RVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPM
LYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i3_Homo sapiensGi/o9336017
2Galpha-i2_Homo sapiensGi/o9336017
3Galpha-z_Homo sapiensGi/o9336017
4Galpha-i1_Homo sapiensGi/o9336017
5Galpha-o_Homo sapiensGi/o9336017
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level