Quick search:







Description Entry page for GPCR - 'FORMYL-PEPTIDE RECEPTORS_FPR3_Homo sapiens'
ClassCLASS A
FamilyFORMYL-PEPTIDE RECEPTORS
Sub-FamilyFPR3
Cross References:
References
UniProtP25089
EMBLM76673 | L14061 | AY262690 | BC059388 | BC069070 | BC069593 | BC069812
InterProIPR000276 | IPR015691 | IPR000826 | IPR017452
PRODOM
GENEID2359
MIM136539
PRINTSPR00526 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameFORMYL-PEPTIDE RECEPTORS_FPR3_Homo sapiens
DescriptionRecName: Full=N-formyl peptide receptor 3;AltName: Full=FMLP-related receptor II; Short=FMLP-R-II;AltName: Full=Formyl peptide receptor-like 2
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneFPR3 | FPRH1,FPRL
FunctionLow affinity receptor for N-formyl-methionyl peptides,s which are powerful neutrophils chemotactic factors
Fragment0
Sequence
METNFSIPLNETEEVLPEPAGHTVLWIFSLLVHGVTFVFGVLGNGLVIWVAGFRMTRTVN
TICYLNLALADFSFSAILPFRMVSVAMREKWPFGSFLCKLVHVMIDINLFVSVYLITIIA
LDRCICVLHPAWAQNHRTMSLAKRVMTGLWIFTIVLTLPNFIFWTTISTTNGDTYCIFNF
AFWGDTAVERLNVFITMAKVFLILHFIIGFSVPMSIITVCYGIIAAKIHRNHMIKSSRPL
RVFAAVVASFFICWFPYELIGILMAVWLKEMLLNGKYKIILVLINPTSSLAFFNSCLNPI
LYVFMGRNFQERLIRSLPTSLERALTEVPDSAQTSNTDTTSASPPEETELQAM
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i1_Homo sapiensGi/o9336017
2Galpha-o_Homo sapiensGi/o9336017
3Galpha-i3_Homo sapiensGi/o9336017
4Galpha-i2_Homo sapiensGi/o9336017
5Galpha-z_Homo sapiensGi/o9336017
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level