Quick search:







Description Entry page for GPCR - 'FREE FATTY ACID RECEPTORS_FFA1_Homo sapiens'
ClassCLASS A
FamilyFREE FATTY ACID RECEPTORS
Sub-FamilyFFA1
Cross References:
References
UniProtO14842 | Q0VAS2 | Q4VBL4
EMBLAF024687 | BC095536 | BC120944
InterProIPR000276 | IPR017452 | IPR013313 | IPR013312
PRODOM
GENEID2864
MIM603820
PRINTSPR01905 | PR00237 | PR01904
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameFREE FATTY ACID RECEPTORS_FFA1_Homo sapiens
DescriptionRecName: Full=Free fatty acid receptor 1;AltName: Full=G-protein coupled receptor 40
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneFFAR1 | GPR4
FunctionReceptor for medium and long chain saturated ands unsaturated fatty acids
Fragment0
Sequence
MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLP
LKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRP
CYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAG
PARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPY
NASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-o_Homo sapiensGi/o17130640
2Galpha-11_Homo sapiensGq/1117130640
3Galpha-14_Homo sapiensGq/1117130640
4Galpha-i1_Homo sapiensGi/o17130640
5Galpha-i3_Homo sapiensGi/o17130640
6Galpha-z_Homo sapiensGi/o17130640
7Galpha-q_Homo sapiensGq/1117130640
8Galpha-i2_Homo sapiensGi/o17130640
9Galpha-15_Homo sapiensGq/1117130640
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level