Quick search:







Description Entry page for GPCR - 'FREE FATTY ACID RECEPTORS_FFA2_Homo sapiens'
ClassCLASS A
FamilyFREE FATTY ACID RECEPTORS
Sub-FamilyFFA2
Cross References:
References
UniProtO15552 | B0M0J9 | Q4VAZ3 | Q4VAZ5 | Q4VBL5
EMBLAF024690 | AC002511 | EU432114 | BC095535 | BC096198 | BC096199 | BC096200 | BC096201
InterProIPR000276 | IPR017452 | IPR013312
PRODOM
GENEID2867
MIM603823
PRINTSPR00237 | PR01904
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameFREE FATTY ACID RECEPTORS_FFA2_Homo sapiens
DescriptionRecName: Full=Free fatty acid receptor 2;AltName: Full=G-protein coupled receptor 43
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneFFAR2 | GPR4
FunctionReceptor for short chain fatty acids through a G(i)-s protein-mediated inhibition of adenylyl cyclase and elevation ofs intracellular calcium
Fragment0
Sequence
MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLL
LLPFKIIEAASNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLS
RRPLYGVIAALVAWVMSFGHCTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVR
LELCLVLFFIPMAVTIFCYWRFVWIMLSQPLVGAQRRRRAVGLAVVTLLNFLVCFGPYNV
SHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLG
RRGKDTAEGTNEDRGVGQGEGMPSSDFTTE
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-o_Homo sapiensGi/o17130640
2Galpha-q_Homo sapiensGq/1117130640
3Galpha-15_Homo sapiensGq/1117130640
4Galpha-14_Homo sapiensGq/1117130640
5Galpha-z_Homo sapiensGi/o17130640
6Galpha-i1_Homo sapiensGi/o17130640
7Galpha-i3_Homo sapiensGi/o17130640
8Galpha-11_Homo sapiensGq/1117130640
9Galpha-i2_Homo sapiensGi/o17130640
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level