Quick search:







Description Entry page for GPCR - 'FREE FATTY ACID RECEPTORS_FFA3_Homo sapiens'
ClassCLASS A
FamilyFREE FATTY ACID RECEPTORS
Sub-FamilyFFA3
Cross References:
References
UniProtO14843 | B2RWM8 | Q14CM7
EMBLAF024688 | BC035657 | BC113695 | BC148269
InterProIPR000276 | IPR017452 | IPR013312
PRODOM
GENEID2865
MIM603821
PRINTSPR00237 | PR01904
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameFREE FATTY ACID RECEPTORS_FFA3_Homo sapiens
DescriptionRecName: Full=Free fatty acid receptor 3;AltName: Full=G-protein coupled receptor 41
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneFFAR3 | GPR4
FunctionReceptor for short chain fatty acids through a G(i)-s protein-mediated inhibition of adenylyl cyclase and elevation ofs intracellular calcium
Fragment0
Sequence
MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLQRRPVAVDVLLLNLTAS
DLLLLLFLPFRMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHP
LWYKTRPRLGQAGLVSVACWLLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFRKDQLAI
LLPVRLEMAVVLFVVPLIITSYCYSRLVWILGRGGSHRRQRRVAGLLAATLLNFLVCFGP
YNVSHVVGYICGESPAWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQ
WQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-o_Homo sapiensGi/o17130640
2Galpha-15_Homo sapiensGq/1117130640
3Galpha-14_Homo sapiensGq/1117130640
4Galpha-i2_Homo sapiensGi/o17130640
5Galpha-q_Homo sapiensGq/1117130640
6Galpha-z_Homo sapiensGi/o17130640
7Galpha-i1_Homo sapiensGi/o17130640
8Galpha-11_Homo sapiensGq/1117130640
9Galpha-i3_Homo sapiensGi/o17130640
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level