Quick search:







Description Entry page for GPCR - 'FREE FATTY ACID RECEPTORS_FFARL_Homo sapiens'
ClassCLASS A
FamilyFREE FATTY ACID RECEPTORS
Sub-FamilyFFARL
Cross References:
References
UniProtO15529
EMBLAF024689 | AC002511
InterProIPR000276 | IPR017452 | IPR013312
PRODOM
GENEID
MIM603822
PRINTSPR00237 | PR01904
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameFREE FATTY ACID RECEPTORS_FFARL_Homo sapiens
DescriptionRecName: Full=Putative G-protein coupled receptor 42
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGPR42P | GPR4
FunctionOrphan receptor
Fragment0
Sequence
MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLRCRPVAVDVLLLNLTAS
DLLLLLFLPFRMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHP
LWYKTRPRLGQAGLVSVACWLLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFWKDQLAI
LLPVRLEMAVVLFVVPLIITSYCYSRLVWILGRGGSHRRQRRVAGLVAATLLNFLVCFGP
YNVSHVVGYICGESPVWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQ
WQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAEN
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-q_Homo sapiensGq/1117130640
2Galpha-i3_Homo sapiensGi/o17130640
3Galpha-14_Homo sapiensGq/1117130640
4Galpha-i1_Homo sapiensGi/o17130640
5Galpha-i2_Homo sapiensGi/o17130640
6Galpha-z_Homo sapiensGi/o17130640
7Galpha-15_Homo sapiensGq/1117130640
8Galpha-o_Homo sapiensGi/o17130640
9Galpha-11_Homo sapiensGq/1117130640
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level