Quick search:







Description Entry page for GPCR - 'GALANIN RECEPTORS_GAL2_Homo sapiens'
ClassCLASS A
FamilyGALANIN RECEPTORS
Sub-FamilyGAL2
Cross References:
References
UniProtO43603 | Q32MN8
EMBLAF040630 | AF080586 | AF058762 | AF042782 | BC069130 | BC074914 | BC074915 | BC109051 | BC109052
InterProIPR000276 | IPR000405 | IPR003907 | IPR017452
PRODOM
GENEID8811
MIM603691
PRINTSPR01419 | PR00663 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameGALANIN RECEPTORS_GAL2_Homo sapiens
DescriptionRecName: Full=Galanin receptor type 2;AltName: Full=GAL2-R;AltName: Full=GALR2
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGALR2 | GALNR
FunctionReceptor for the hormone galanin and for GALP
Fragment0
Sequence
MNVSGCPGAGNASQAGGGGGWHPEAVIVPLLFALIFLVGTVGNTLVLAVLLRGGQAVSTT
NLFILNLGVADLCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVS
LDRYLAIRYPLHSRELRTPRNALAAIGLIWGLSLLFSGPYLSYYRQSQLANLTVCHPAWS
APRRRAMDICTFVFSYLLPVLVLGLTYARTLRYLWRAVDPVAAGSGARRAKRKVTRMILI
VAALFCLCWMPHHALILCVWFGQFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFR
KGFRTICAGLLGRAPGRASGRVCAAARGTHSGSVLERESSDLLHMSEAAGALRPCPGASQ
PCILEPCPGPSWQGPKAGDSILTVDVA
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i2_Homo sapiensGi/o9685625
2Galpha-z_Homo sapiensGi/o9685625
3Galpha-o_Homo sapiensGi/o9685625
4Galpha-i1_Homo sapiensGi/o9685625
5Galpha-11_Homo sapiensGq/119685625
6Galpha-14_Homo sapiensGq/119685625
7Galpha-q_Homo sapiensGq/119685625
8Galpha-i3_Homo sapiensGi/o9685625
9Galpha-15_Homo sapiensGq/119685625
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level