Quick search:







Description Entry page for GPCR - 'GALANIN RECEPTORS_GAL3_Homo sapiens'
ClassCLASS A
FamilyGALANIN RECEPTORS
Sub-FamilyGAL3
Cross References:
References
UniProtO60755
EMBLAF073799 | AF067733 | AF129514 | AF129513 | AB065934 | Z97630
InterProIPR000276 | IPR000405 | IPR003908 | IPR017452
PRODOM
GENEID8484
MIM603692
PRINTSPR01420 | PR00663 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameGALANIN RECEPTORS_GAL3_Homo sapiens
DescriptionRecName: Full=Galanin receptor type 3;AltName: Full=GAL3-R;AltName: Full=GALR3
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGALR3 | GALNR
FunctionReceptor for the hormone galanin
Fragment0
Sequence
MADAQNISLDSPGSVGAVAVPVVFALIFLLGTVGNGLVLAVLLQPGPSAWQEPGSTTDLF
ILNLAVADLCFILCCVPFQATIYTLDAWLFGALVCKAVHLLIYLTMYASSFTLAAVSVDR
YLAVRHPLRSRALRTPRNARAAVGLVWLLAALFSAPYLSYYGTVRYGALELCVPAWEDAR
RRALDVATFAAGYLLPVAVVSLAYGRTLRFLWAAVGPAGAAAAEARRRATGRAGRAMLAV
AALYALCWGPHHALILCFWYGRFAFSPATYACRLASHCLAYANSCLNPLVYALASRHFRA
RFRRLWPCGRRRRHRARRALRRVRPASSGPPGCPGDARPSGRLLAGGGQGPEPREGPVHG
GEAARGPE
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-z_Homo sapiensGi/o9722565
2Galpha-o_Homo sapiensGi/o9722565
3Galpha-i2_Homo sapiensGi/o9722565
4Galpha-i3_Homo sapiensGi/o9722565
5Galpha-i1_Homo sapiensGi/o9722565
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level