Quick search:







Description Entry page for GPCR - 'GHRELIN RECEPTORS_Ghrelin_Homo sapiens'
ClassCLASS A
FamilyGHRELIN RECEPTORS
Sub-FamilyGhrelin
Cross References:
References
UniProtQ92847 | Q14D12 | Q92848 | Q96RJ7
EMBLU60179 | U60181 | AF369786 | AF369786 | AY429112 | AY322544 | BC113547
InterProIPR000276 | IPR003905 | IPR017452
PRODOM
GENEID2693
MIM601898 | 604271
PRINTSPR01417 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameGHRELIN RECEPTORS_Ghrelin_Homo sapiens
DescriptionRecName: Full=Growth hormone secretagogue receptor type 1; Short=GHS-R;AltName: Full=GH-releasing peptide receptor; Short=GHRP; Short=Ghrelin receptor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGHS
FunctionReceptor for ghrelin, coupled to G-alpha-11 proteins
Fragment0
Sequence
MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ
FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV
LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI
SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT
ESSINT
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-11_Homo sapiensGq/1114755130 | 8688086
2Galpha-q_Homo sapiensGq/1114755130 | 8688086
3Galpha-14_Homo sapiensGq/1114755130 | 8688086
4Galpha-15_Homo sapiensGq/1114755130 | 8688086
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level