Quick search:







Description Entry page for GPCR - 'GLYCOPROTEIN HORMONE RECEPTORS_TSH_Homo sapiens'
ClassCLASS A
FamilyGLYCOPROTEIN HORMONE RECEPTORS
Sub-FamilyTSH
Cross References:
References
UniProtP16473 | Q9P1V4 | Q9ULA3 | Q9UPH3
EMBLM31774 | M32215 | M73747 | AY429111 | AC007262 | AC010072 | AC010582 | AL136040 | S45272
InterProIPR000276 | IPR017452 | IPR002131 | IPR002274
PRODOM
GENEID7253
MIM275000 | 275200 | 603372 | 603373 | 609152
PRINTSPR00373 | PR00237 | PR01145
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameGLYCOPROTEIN HORMONE RECEPTORS_TSH_Homo sapiens
DescriptionRecName: Full=Thyrotropin receptor;AltName: Full=Thyroid-stimulating hormone receptor; Short=TSH-R;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneTSHR | LGR
FunctionReceptor for thyrothropin
Fragment0
Sequence
MRPADLLQLVLLLDLPRDLGGMGCSSPPCECHQEEDFRVTCKDIQRIPSLPPSTQTLKLI
ETHLRTIPSHAFSNLPNISRIYVSIDVTLQQLESHSFYNLSKVTHIEIRNTRNLTYIDPD
ALKELPLLKFLGIFNTGLKMFPDLTKVYSTDIFFILEITDNPYMTSIPVNAFQGLCNETL
TLKLYNNGFTSVQGYAFNGTKLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLDVSQTSVTA
LPSKGLEHLKELIARNTWTLKKLPLSLSFLHLTRADLSYPSHCCAFKNQKKIRGILESLM
CNESSMQSLRQRKSVNALNSPLHQEYEENLGDSIVGYKEKSKFQDTHNNAHYYVFFEEQE
DEIIGFGQELKNPQEETLQAFDSHYDYTICGDSEDMVCTPKSDEFNPCEDIMGYKFLRIV
VWFVSLLALLGNVFVLLILLTSHYKLNVPRFLMCNLAFADFCMGMYLLLIASVDLYTHSE
YYNHAIDWQTGPGCNTAGFFTVFASELSVYTLTVITLERWYAITFAMRLDRKIRLRHACA
IMVGGWVCCFLLALLPLVGISSYAKVSICLPMDTETPLALAYIVFVLTLNIVAFVIVCCC
YVKIYITVRNPQYNPGDKDTKIAKRMAVLIFTDFICMAPISFYALSAILNKPLITVSNSK
ILLVLFYPLNSCANPFLYAIFTKAFQRDVFILLSKFGICKRQAQAYRGQRVPPKNSTDIQ
VQKVTHDMRQGLHNMEDVYELIENSHLTPKKQGQISEEYMQTVL
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-s_Homo sapiens_1Gs8552586
2Galpha-i3_Homo sapiensGi/o8552586
3Galpha-q_Homo sapiensGq/118552586
4Galpha-s_Homo sapiens_2Gs8552586
5Galpha-i2_Homo sapiensGi/o8552586
6Galpha-z_Homo sapiensGi/o8552586
7Galpha-15_Homo sapiensGq/118552586
8Galpha-14_Homo sapiensGq/118552586
9Galpha-11_Homo sapiensGq/118552586
10Galpha-o_Homo sapiensGi/o8552586
11Galpha-12_Homo sapiensG12/138552586
12Galpha-i1_Homo sapiensGi/o8552586
13Galpha-13_Homo sapiensG12/138552586
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level