Quick search:







Description Entry page for GPCR - 'GONADOTROPIN-RELEASING HORMONE RECEPTORS_GNRH_Homo sapiens'
ClassCLASS A
FamilyGONADOTROPIN-RELEASING HORMONE RECEPTORS
Sub-FamilyGNRH
Cross References:
References
UniProtP30968 | O75793 | Q14D13 | Q92644
EMBLL03380 | L07949 | S60587 | S77472 | AF001952 | AF001950 | AF001951 | Z81148 | AY392011 | BC113546 | Z99995
InterProIPR000276 | IPR015693 | IPR017452 | IPR001658
PRODOM
GENEID2798
MIM138850 | 146110 | 228300
PRINTSPR00529 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameGONADOTROPIN-RELEASING HORMONE RECEPTORS_GNRH_Homo sapiens
DescriptionRecName: Full=Gonadotropin-releasing hormone receptor; Short=GnRH receptor; Short=GnRH-R
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNRHR | GRH
FunctionReceptor for gonadotropin releasing hormone (GnRH) thats mediate the action of GnRH to stimulate the secretion of thes gonadotropic hormones (LH and FSH)
Fragment0
Sequence
MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKL
QKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRM
IHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTR
VLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRL
SDPVNHFFFLFAFLNPCFDPLIYGYFSL
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-14_Homo sapiensGq/111333190
2Galpha-q_Homo sapiensGq/111333190
3Galpha-11_Homo sapiensGq/111333190
4Galpha-15_Homo sapiensGq/111333190
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level