Quick search:







Description Entry page for GPCR - 'GONADOTROPIN-RELEASING HORMONE RECEPTORS_GNRH2_Homo sapiens'
ClassCLASS A
FamilyGONADOTROPIN-RELEASING HORMONE RECEPTORS
Sub-FamilyGNRH2
Cross References:
References
UniProtQ96P88 | Q8TCX8
EMBLAF403014 | AY081843 | AL160282
InterProIPR000276 | IPR001658
PRODOM
GENEID
MIM
PRINTSPR00529 | PR00237
PFAM
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameGONADOTROPIN-RELEASING HORMONE RECEPTORS_GNRH2_Homo sapiens
DescriptionRecName: Full=Putative gonadotropin-releasing hormone II receptor;AltName: Full=Type II GnRH receptor;AltName: Full=GnRH-II-R
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNRHR
FunctionReceptor for gonadotropin releasing hormone II (GnRHs II)
Fragment0
Sequence
MSAGNGTPWGSAAGEEVWAGSGVEVEGSELPTFSAAAKVRVGVTIVLFVSSAGGNLAVLW
SVTRREPSQLRPSPVRRLFIHLAAADLLVTFVVMPLDATWNITVQWLAVDIACRTLMFLK
LMATYSAAFLPVVIGLDRQAAVLNPLGSRSGVRKLLGAAWGLSFLLAFPQLFLFHTVH
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-15_Homo sapiensGq/111333190
2Galpha-q_Homo sapiensGq/111333190
3Galpha-11_Homo sapiensGq/111333190
4Galpha-14_Homo sapiensGq/111333190
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level