Quick search:







Description Entry page for GPCR - 'HISTAMINE RECEPTORS_H1_Homo sapiens'
ClassCLASS A
FamilyHISTAMINE RECEPTORS
Sub-FamilyH1
Cross References:
References
UniProtP35367 | Q6P9E5
EMBLZ34897 | X76786 | D14436 | D28481 | AF026261 | AB041380 | AY136743 | BC060802
InterProIPR000276 | IPR017452 | IPR000921
PRODOM
GENEID3269
MIM600167
PRINTSPR00237 | PR00530
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameHISTAMINE RECEPTORS_H1_Homo sapiens
DescriptionRecName: Full=Histamine H1 receptor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneHRH
FunctionIn peripheral tissues, the H1 subclass of histamines receptors mediates the contraction of smooth muscles, increase ins capillary permeability due to contraction of terminal venules, ands catecholamine release from adrenal medulla, as well as mediatings neurotransmission in the central nervous system
Fragment0
Sequence
MSLPNSSCLLEDKMCEGNKTTMASPQLMPLVVVLSTICLVTVGLNLLVLYAVRSERKLHT
VGNLYIVSLSVADLIVGAVVMPMNILYLLMSKWSLGRPLCLFWLSMDYVASTASIFSVFI
LCIDRYRSVQQPLRYLKYRTKTRASATILGAWFLSFLWVIPILGWNHFMQQTSVRREDKC
ETDFYDVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVRQHCQHRELINRSLPSFSEIKLR
PENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKL
YCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSR
TDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQLGFI
MAAFILCWIPYFIFFMVIAFCKNCCNEHLHMFTIWLGYINSTLNPLIYPLCNENFKKTFK
RILHIRS
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-15_Homo sapiensGq/111722337
2Galpha-14_Homo sapiensGq/111722337
3Galpha-11_Homo sapiensGq/111722337
4Galpha-q_Homo sapiensGq/111722337
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level