Quick search:







Description Entry page for GPCR - 'HISTAMINE RECEPTORS_H2_Homo sapiens'
ClassCLASS A
FamilyHISTAMINE RECEPTORS
Sub-FamilyH2
Cross References:
References
UniProtP25021 | Q14464
EMBLM64799 | D49783 | AB023486 | AB041384 | AY136744 | X98133
InterProIPR000276 | IPR017452 | IPR000503
PRODOM
GENEID3274
MIM142703
PRINTSPR00237 | PR00531
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameHISTAMINE RECEPTORS_H2_Homo sapiens
DescriptionRecName: Full=Histamine H2 receptor; Short=H2R;AltName: Full=Gastric receptor I
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneHRH
FunctionThe H2 subclass of histamine receptors mediates gastrics acid secretion
Fragment0
Sequence
MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSL
AITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
MDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNE
VYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVM
GAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ
QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-s_Homo sapiens_1Gs1703298
2Galpha-s_Homo sapiens_2Gs1703298
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level